ESTScan Details for Unigene SGN-U217237

Score 
883
Direction 
Forward
Predicted Peptide Sequence 
PGPKINKDGALQMLATNIEYEEHKGRIAIGRVHAGSLRRGMDVKICTSEDACRFGRVSELFVYEKFSRVPAETVEAGDICAVCGIDDIQI
GETIADKSDGKPLPSIKVEEPTVKMSFSVNTSPFVGREGKYVTSRNLRDRLYRELERNLAMKVEDGETADTFIVSGRGTLHITILIENMR
REGYEFMVGPPKVINKRVNDKLLEPYEIATVEVPEEHMGSVVELLGKRRGQMFDMQGLGSEGTSFLKYKIPTRGLLGLRNSILTASRGTA
ILNTVFESYESWAGDISTRDLGSLVAFEDGTSTSYALMSSQDRGQLFIGPGVDVYKGQIVGIHQRSGDLALNVCKKKAATNVRSNKEVTV
VLDTPLDFSLDDCIEYIQEDELVEVTPSSIRDAEKPKVCQKNAMRVHIGRGKEM
Predicted Coding Sequence 
CCAGGGCCCAAGATTAATAAAGATGGTGCACTTCAAATGCTTGCTACAAATATTGAGTATGAAGAACATAAAGGGCGCATAGCTATTGGA
CGTGTGCATGCTGGAAGTCTGCGCAGGGGAATGGATGTGAAGATATGTACATCTGAAGACGCATGCAGATTCGGCAGAGTAAGTGAGTTA
TTTGTGTATGAGAAATTCAGTAGAGTTCCTGCTGAAACTGTTGAAGCTGGAGATATTTGTGCGGTGTGTGGCATTGATGATATTCAGATC
GGAGAGACTATCGCTGACAAAAGCGATGGAAAACCATTACCTTCAATCAAGGTTGAAGAACCTACAGTGAAAATGTCATTTTCAGTCAAT
ACATCCCCCTTTGTTGGCCGTGAGGGAAAGTATGTTACTAGTCGAAACCTAAGAGACCGGTTGTACCGTGAGCTGGAAAGAAATCTGGCA
ATGAAAGTTGAAGATGGTGAAACTGCAGATACGTTCATTGTCAGTGGACGTGGTACTTTGCATATTACCATCCTGATAGAGAACATGCGA
AGGGAAGGATACGAGTTCATGGTGGGACCTCCTAAAGTGATAAATAAGAGAGTGAACGACAAGTTGCTGGAACCTTATGAGATTGCTACT
GTTGAGGTTCCTGAAGAACACATGGGGTCTGTGGTTGAACTTCTGGGGAAAAGGCGTGGTCAGATGTTTGATATGCAAGGGCTTGGGTCT
GAAGGAACATCCTTCCTCAAATATAAAATACCTACCCGTGGTCTTCTTGGATTGAGGAATTCAATCTTGACAGCTTCTAGGGGCACAGCA
ATTCTCAACACAGTATTTGAGAGCTATGAATCATGGGCTGGTGATATTTCTACTCGCGATCTTGGTTCACTGGTTGCATTTGAGGACGGA
ACAAGTACATCGTACGCACTCATGAGTTCTCAGGACAGAGGACAGTTGTTTATTGGCCCTGGAGTTGATGTTTATAAAGGTCAAATAGTT
GGTATTCACCAACGGTCAGGTGACCTTGCCCTGAATGTCTGCAAGAAAAAAGCTGCAACAAATGTCCGTTCAAACAAAGAAGTAACAGTG
GTTCTTGATACCCCACTAGATTTTAGTCTGGATGATTGCATAGAGTACATTCAAGAAGATGAGCTTGTTGAAGTTACTCCATCAAGTATC
CGXGATGCTGAAAAACCCAAAGTCTGCCAAAAAAATGCGATGAGGGTTCACATAGGACGAGGCAAAGAGATGTGA\
Edits in Original Sequence 
(5')CCAGGGCCCAAGATTAATAAAGATGGTGCACTTCAAATGCTTGCTACAAATATTGAGTATGAAGAACATAAAGGGCGCATAGCTAT
TGGACGTGTGCATGCTGGAAGTCTGCGCAGGGGAATGGATGTGAAGATATGTACATCTGAAGACGCATGCAGATTCGGCAGAGTAAGTGA
GTTATTTGTGTATGAGAAATTCAGTAGAGTTCCTGCTGAAACTGTTGAAGCTGGAGATATTTGTGCGGTGTGTGGCATTGATGATATTCA
GATCGGAGAGACTATCGCTGACAAAAGCGATGGAAAACCATTACCTTCAATCAAGGTTGAAGAACCTACAGTGAAAATGTCATTTTCAGT
CAATACATCCCCCTTTGTTGGCCGTGAGGGAAAGTATGTTACTAGTCGAAACCTAAGAGACCGGTTGTACCGTGAGCTGGAAAGAAATCT
GGCAATGAAAGTTGAAGATGGTGAAACTGCAGATACGTTCATTGTCAGTGGACGTGGTACTTTGCATATTACCATCCTGATAGAGAACAT
GCGAAGGGAAGGATACGAGTTCATGGTGGGACCTCCTAAAGTGATAAATAAGAGAGTGAACGACAAGTTGCTGGAACCTTATGAGATTGC
TACTGTTGAGGTTCCTGAAGAACACATGGGGTCTGTGGTTGAACTTCTGGGGAAAAGGCGTGGTCAGATGTTTGATATGCAAGGGCTTGG
GTCTGAAGGAACATCCTTCCTCAAATATAAAATACCTACCCGTGGTCTTCTTGGATTGAGGAATTCAATCTTGACAGCTTCTAGGGGCAC
AGCAATTCTCAACACAGTATTTGAGAGCTATGAATCATGGGCTGGTGATATTTCTACTCGCGATCTTGGTTCACTGGTTGCATTTGAGGA
CGGAACAAGTACATCGTACGCACTCATGAGTTCTCAGGACAGAGGACAGTTGTTTATTGGCCCTGGAGTTGATGTTTATAAAGGTCAAAT
AGTTGGTATTCACCAACGGTCAGGTGACCTTGCCCTGAATGTCTGCAAGAAAAAAGCTGCAACAAATGTCCGTTCAAACAAAGAAGTAAC
AGTGGTTCTTGATACCCCACTAGATTTTAGTCTGGATGATTGCATAGAGTACATTCAAGAAGATGAGCTTGTTGAAGTTACTCCATCAAG
TATCCGXGATGCTGAAAAACCCAAAGTCTGCCAAAAAAATGCGATGAGGGTTCACATAGGACGAGGCAAAGAGATGTGA\(3')TGAAGT
ATACATAGGACGAGACAATATACATGTTACCCAGCTCATCATTTCATTCAAAAGCCTCTCTCTTTTGGACAGTGCATATAGGATCATTAG
CATGTTGGTACTTTTAACATGTGAATTGAACTTTTCGTTAATGCAGAGCTATACTGCATTCAAAGCCTTAAATACAATAGGTTGAAACCT
TTTGGTAGTTGGATTTGGTTAGGCATACAAAGGCGTGGTATATTTCTCACAATTTGTATAGATAATATAATAGAGTGCAAAACAATTTGC
AATATTTGGTATTGTAATAACTATTATAGCATTATCATATTCCATATTTTTGTGTAAGATGTGCTTAATGGGAAAAAACAGATTTAAAAA
AAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan