Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U217345

Score 
769
Direction 
Forward
Predicted Peptide Sequence 
GGTPLYAQCTTLNAEESEEIQECIVAVGSPPISFERTLRIRGKNNPSRSDFSAXDLFVRVIAXVELVMANDDDFTFCQVGAPDNQDYVDT
QKIAHDISEIRIKDEPSNNDGTSQSNGAPWEGKLGNITTSKKQGTVGSLSFTVIDTSPGKQASRTSGQVALKDGGFSVPTYQKEIKPARK
PVVRAKVPYEKGYSQMDWLKLTRTHPDLAGLNGQSNRRLISMDEVKEHQNAEAMWTVLKGHVYNITPYMKFHPGGVDMLMKAVGKDCTAL
FNKYHAWVNAEVLMEKCLVGILDDSK
Predicted Coding Sequence 
XTTGGTGGTACTCCTCTTTATGCACAATGTACCACTCTAAATGCAGAGGAATCAGAAGAAATTCAAGAATGTATCGTAGCXGTAGGTAGT
CCGCCCATCAGCTTTGAACGAACATTGCGAATTAGAGGGAAAAACAACCCCTCAAGATCAGATTTCTCGGCGAXGGACCTTTTTGTTCGT
GTCATTGCTXCAGTTGAGCTAGTAATGGCTAATGATGATGATTTCACTTTTTGTCAGGTTGGAGCACCTGATAATCAAGATTATGTGGAT
ACACAGAAGATTGCTCATGATATTAGTGAAATTAGAATAAAAGATGAGCCCTCAAATAATGATGGTACTAGTCAAAGTAATGGTGCACCA
TGGGAAGGTAAATTGGGCAATATTACTACCTCAAAGAAGCAGGGAACAGTTGGTTCTTTGTCTTTCACTGTTATAGACACATCTCCAGGC
AAGCAAGCAAGTAGAACTTCTGGTCAAGTGGCATTAAAAGATGGTGGATTTTCAGTCCCAACTTATCAGAAGGAAATAAAACCTGCTAGG
AAGCCTGTAGTTCGAGCCAAGGTCCCCTATGAGAAGGGTTATAGTCAGATGGACTGGCTAAAGCTTACAAGAACACATCCTGACCTTGCA
GGATTAAATGGACAGTCCAACAGGAGACTTATATCAATGGATGAAGTTAAGGAACACCAAAATGCAGAAGCAATGTGGACTGTTCTTAAA
GGGCATGTCTACAATATAACACCATACATGAAGTTTCACCCAGGAGGGGTAGACATGCTGATGAAGGCCGTAGGAAAAGATTGCACGGCA
TTGTTTAACAAATACCATGCTTGGGTTAATGCTGAAGTTCTAATGGAGAAATGTCTTGTGGGCATTTTGGATGACAGCAAATAA\
Edits in Original Sequence 
(5')XTTGGTGGTACTCCTCTTTATGCACAATGTACCACTCTAAATGCAGAGGAATCAGAAGAAATTCAAGAATGTATCGTAGCXGTAGG
TAGTCCGCCCATCAGCTTTGAACGAACATTGCGAATTAGAGGGAAAAACAACCCCTCAAGATCAGATTTCTCGGCGAXGGACCTTTTTGT
TCGTGTCATTGCTXCAGTTGAGCTAGTAATGGCTAATGATGATGATTTCACTTTTTGTCAGGTTGGAGCACCTGATAATCAAGATTATGT
GGATACACAGAAGATTGCTCATGATATTAGTGAAATTAGAATAAAAGATGAGCCCTCAAATAATGATGGTACTAGTCAAAGTAATGGTGC
ACCATGGGAAGGTAAATTGGGCAATATTACTACCTCAAAGAAGCAGGGAACAGTTGGTTCTTTGTCTTTCACTGTTATAGACACATCTCC
AGGCAAGCAAGCAAGTAGAACTTCTGGTCAAGTGGCATTAAAAGATGGTGGATTTTCAGTCCCAACTTATCAGAAGGAAATAAAACCTGC
TAGGAAGCCTGTAGTTCGAGCCAAGGTCCCCTATGAGAAGGGTTATAGTCAGATGGACTGGCTAAAGCTTACAAGAACACATCCTGACCT
TGCAGGATTAAATGGACAGTCCAACAGGAGACTTATATCAATGGATGAAGTTAAGGAACACCAAAATGCAGAAGCAATGTGGACTGTTCT
TAAAGGGCATGTCTACAATATAACACCATACATGAAGTTTCACCCAGGAGGGGTAGACATGCTGATGAAGGCCGTAGGAAAAGATTGCAC
GGCATTGTTTAACAAATACCATGCTTGGGTTAATGCTGAAGTTCTAATGGAGAAATGTCTTGTGGGCATTTTGGATGACAGCAAATAA\
(3')AAGCTCCTTGTTTCATTGATCCCAGAAACAACTGTATCAAGAAAAACATTCTCACTACAAGAAGATTGTCCTTAACAGAAAACAAGA
TATTTTGCTTCTTCTGAGGAAAAGCTTACATGCTATAGTATATTGGAGTAACTATTTACATACTCAAGGATTTTGAATTTTTTTAAAGCT
GTATGTCAAAGAAACTGTCTGAATCTTAGACTAATAAAACTTCAAGAAGCAGAAGCATCCTCTGTTATATTCATTAAAAAAAAAAAAAAA
A

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan