ESTScan Details for Unigene SGN-U217387

Score 
646
Direction 
Forward
Predicted Peptide Sequence 
QFRMRGLGRGLSVANLTPALAGREAVSNNRRLSENKNXNIYEDISSNNNRITLIVTQYILISHIVAPDFEPVLLNPRICVMKSPTSRSTS
VSDAHFHNMNELKEFCKSVNKVENMYLLTFFSTYXNLAGLRAIFYLTIYFIVSDLELKPTGVLEVKLVQAKELTNKDIIGKSDPFAELYV
RPVRDRMKKSKTINNELNPIWNEHFEFVVEDPLTQHLVIKIYDDEGLQAAELIGCAHVRLNELEPGKVKDVWLKLVKDLEIQRDQKNRGQ
VHLELLYCPYGMTNGFSNPFANNVPLTSLEKVLKSGVEAAQNGGEINRRKDVIVRGVLSVTVISAEDLAPTDLLGKADPYVVVTMKKTET
KNKTRVVPESLNPVWNQTFDFVVEDGLHDMLILEVWDHDTFGKDYMGRCILTLTRVLMEGEYKETFELDGAKSGKLNLHLKWAPQPIYRD
S
Predicted Coding Sequence 
XXGCAGTTCCGCATGCGGGGTCTGGGTAGGGGGTTGAGTGTGGCAAACCTTACCCCTGCCTTGGCAGGTAGAGAGGCTGTTTCCAATAAC
CGTCGGCTCAGTGAAAACAAAAACAXCAACATTTATGAAGATATAAGCAGTAACAACAACAGGATAACTCTTATTGTGACACAATATATT
CTTATTAGCCATATCGTAGCACCAGACTTTGAACCXGTACTCCTGAATCCTAGAATTTGTGTAATGAAGAGTCCAACCTCTAGATCAACA
TCTGTATCAGATGCCCACTTTCATAACATGAATGAGCTTAAAGAATTTTGTAAGTCTGTGAATAAAGTAGAAAACATGTATTTGTTGACT
TTCTTCTCTACTTATXCTAACCTTGCTGGGCTGAGAGCCATTTTCTATTTGACAATCTACTTTATTGTTAGTGACCTTGAACTGAAACCT
ACTGGAGTATTGGAGGTGAAACTTGTTCAAGCAAAAGAGTTAACAAACAAGGACATCATTGGTAAATCTGATCCTTTTGCTGAGTTATAT
GTACGCCCTGTACGAGATAGAATGAAGAAGAGCAAAACAATTAACAACGAACTGAATCCAATCTGGAATGAGCATTTCGAGTTTGTAGTT
GAAGATCCATTGACACAACACTTGGTGATAAAGATCTATGATGATGAAGGGCTTCAAGCAGCTGAACTAATTGGATGCGCACATGTTCGT
TTGAATGAGCTTGAGCCTGGTAAAGTGAAGGATGTTTGGCTGAAGTTGGTGAAAGATTTGGAGATCCAGAGAGACCAAAAGAATAGGGGC
CAGGTGCACTTGGAGCTATTATATTGTCCTTATGGCATGACAAATGGATTCAGTAACCCTTTTGCCAATAATGTACCATTGACTTCACTG
GAGAAGGTTCTTAAAAGTGGAGTAGAAGCTGCCCAAAATGGAGGTGAAATCAACAGGAGGAAGGATGTAATAGTACGAGGGGTACTCTCT
GTAACCGTGATATCAGCTGAGGATCTGGCCCCTACTGATCTACTGGGGAAAGCTGATCCATATGTTGTAGTTACAATGAAGAAGACTGAA
ACAAAGAACAAAACCAGGGTTGTACCAGAAAGCTTAAATCCAGTATGGAATCAGACTTTTGACTTTGTCGTTGAGGACGGATTGCATGAT
ATGTTAATTTTAGAAGTTTGGGACCATGACACCTTCGGAAAGGATTACATGGGAAGGTGCATATTGACATTGACAAGAGTACTAATGGAA
GGTGAATATAAAGAAACCTTTGAACTAGATGGAGCTAAATCAGGGAAACTGAACTTGCATCTCAAATGGGCACCACAGCCTATATACAGA
GACTCCTAATGA\
Edits in Original Sequence 
(5')XXGCAGTTCCGCATGCGGGGTCTGGGTAGGGGGTTGAGTGTaGGCAAACCTTACCCCTGCCTTGGCAGGTAGAGAGGCTGTTTCCA
ATAgACCGTCGGCTCAGTGAAAACAAAAACAXCAACATTTATGAAGATATAAGCAGTAACAACAACAGGATAACTCTTaATTGTGACACA
ATATATTCTTATTAGCCATATCGTAGCACCAGACTTTGAACCXGTACTCCTGAATCCTAGAATTTGTGTAATGAAGAGTCCAACCTCTAG
ATCAACATCTGTATCAGATGCCCACTTTCATAACATGAATGAGCTTAAtAGAATTTTGTAAGTCTGTGAATAAAGTAGAAAACATGTATT
TGTTGACTTTCTTCTCTACTTATXCTAACCTTGCTGGGCTGAGAcGCCATTTTCTATTTGACAATCTACTTTATTGTTAGTGACCTTGAA
CTGAAACCTACTGGAGTATTGGAGGTGAAACTTGTTCAAGCAAAAGAGTTAACAAACAAGGACATCATTGGTAAATCTGATCCTTTTGCT
GAGTTATATGTACGCCCTGTACGAGATAGAATGAAGAAGAGCAAAACAATTAACAACGAACTGAATCCAATCTGGAATGAGCATTTCGAG
TTTGTAGTTGAAGATCCATTGACACAACACTTGGTGATAAAGATCTATGATGATGAAGGGCTTCAAGCAGCTGAACTAATTGGATGCGCA
CATGTTCGTTTGAATGAGCTTGAGCCTGGTAAAGTGAAGGATGTTTGGCTGAAGTTGGTGAAAGATTTGGAGATCCAGAGAGACCAAAAG
AATAGGGGCCAGGTGCACTTGGAGCTATTATATTGTCCTTATGGCATGACAAATGGATTCAGTAACCCTTTTGCCAATAATGTACCATTG
ACTTCACTGGAGAAGGTTCTTAAAAGTGGAGTAGAAGCTGCCCAAAATGGAGGTGAAATCAACAGGAGGAAGGATGTAATAGTACGAGGG
GTACTCTCTGTAACCGTGATATCAGCTGAGGATCTGGCCCCTACTGATCTACTGGGGAAAGCTGATCCATATGTTGTAGTTACAATGAAG
AAGACTGAAACAAAGAACAAAACCAGGGTTGTACCAGAAAGCTTAAATCCAGTATGGAATCAGACTTTTGACTTTGTCGTTGAGGACGGA
TTGCATGATATGTTAATTTTAGAAGTTTGGGACCATGACACCTTCGGAAAGGATTACATGGGAAGGTGCATATTGACATTGACAAGAGTA
CTAATGGAAGGTGAATATAAAGAAACCTTTGAACTAGATGGAGCTAAATCAGGGAAACTGAACTTGCATCTCAAATGGGCACCACAGCCT
ATATACAGAGACTCCTAATGA\(3')TTTAATATCATATGATATGTTGTTGTTTTTGTAAGAGTTGTACAGACACAAGTTTCTTCGATTC
TGTATGTCGATCGTAGACTATATGAAAATTTGTAGAGTGATAGTAGTACATTTTTGTAGATAATTGTTCTGTTAATGCTGAGTTGGCCTA
CTACATATGTAGTTTAGAGAGAAAAAGCATTTTGCTTGGTTAAAAGGAATTTATGTAGAGAGGTGGCATAAGGCAGCAGTTTCTTTTTGG
AAAAATTACAAGGTGTTGCAGCTTTTCACTATTCAGAAATTAACCATTTCTGTATTTTGCAAAAATACATTATTTTTTCTGATATGTCAT
GTATTGTTGTTGTGTAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan