Notice: Please give us important feedback on the future of SGN using this survey: https://www.surveymonkey.com/r/VJTRHVC

ESTScan Details for Unigene SGN-U217391

Score 
656
Direction 
Forward
Predicted Peptide Sequence 
MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALTYSLGVLALRRPFIHKILDYEDECFALLTLVLETHSLRTTDGSFAESLYGLRRRAVNIK
VKGDNKGLDAREEINHTGLEKRQKVLSVVFLVILPYLRSKLHSIYNKEREAALQASLWGTEDERFGDTDYFDGNGNSIVSTSSSDTEESV
RDRLRKKIRKIVAVCYPWIHAGNEGLSFAYQLLYLLDATGFYSLGLHALGIHVCRATRQDLMX
Predicted Coding Sequence 
ATGTTGTTTCAAGTAGGAGGACAAGGGACTCGTCCTACTTTCTTTGAAATGGCTGCTGCACAACAGTTGCCTTCTAGTCTTAGAGCTGCT
TTAACTTATTCCCTTGGTGTTTTAGCTTTAAGAAGACCTTTCATCCACAAAATTCTAGATTATGAGGATGAGTGCTTTGCTTTGCTTACG
CTAGTTCTTGAAACTCATAGCTTACGAACTACAGATGGGTCTTTTGCTGAGTCTTTATATGGTCTGCGAAGAAGGGCAGTTAACATAAAA
GTTAAGGGTGATAACAAAGGTCTAGACGCCAGAGAAGAAATTAATCACACTGGGTTGGAGAAGCGCCAAAAAGTTCTTTCAGTTGTGTTT
CTGGTCATATTGCCATATCTCAGATCAAAATTGCATTCAATCTACAATAAAGAAAGAGAGGCTGCTCTTCAAGCTAGTTTATGGGGCACT
GAGGATGAGAGATTTGGTGACACTGACTATTTTGATGGAAATGGAAACTCCATAGTTTCAACAAGCAGTTCAGATACAGAAGAATCAGTT
AGAGATCGTTTGAGAAAGAAAATCCGTAAGATCGTAGCTGTTTGCTACCCATGGATACATGCTGGAAATGAAGGTTTATCATTTGCTTAC
CAGCTACTGTATTTGCTGGATGCTACTGGATTTTACTCTCTAGGACTCCATGCCCTTGGCATTCATGTCTGTCGGGCTACAAGACAGGAT
CTGATGGAX\
Edits in Original Sequence 
GAACCAAAAAAAAAGAAGCAGCAGAAGAAAAAACTGTTCTTTATCATCTTCCTTCTTCCCAAAACATCTCAATTTCATCACTGAGAAGCA
AAAGAAGAAGACAATCGGAGAAGCAGAAGCAGATAATCAGTTGAGAGGATAAGCGTTTTTTGTTGTTGTACAGAAGAG
(5')ATGTTGTT
TCAAGTAGGAGGACAAGGGACTCGTCCTACTTTCTTTGAAATGGCTGCTGCACAACAGTTGCCTTCTAGTCTTAGAGCTGCTTTAACTTA
TTCCCTTGGTGTTTTAGCTTTAAGAAGACCTTTCATCCACAAAATTCTAGATTATGAGGATGAGTGCTTTGCTTTGCTTACGCTAGTTCT
TGAAACTCATAGCTTACGAACTACAGATGGGTCTTTTGCTGAGTCTTTATATGGTCTGCGAAGAAGGGCAGTTAACATAAAAGTTAAGGG
TGATAACAAAGGTCTAGACGCCAGAGAAGAAATTAATCACACTGGGTTGGAGAAGCGCCAAAAAGTTCTTTCAGTTGTGTTTCTGGTCAT
ATTGCCATATCTCAGATCAAAATTGCATTCAATCTACAATAAAGAAAGAGAGGCTGCTCTTCAAGCTAGTTTATGGGGCACTGAGGATGA
GAGATTTGGTGACACTGACTATTTTGATGGAAATGGAAACTCCATAGTTTCAACAAGCAGTTCAGATACAGAAGAATCAGTTAGAGATCG
TTTGAGAAAGAAAATCCGTAAGATCGTAGCTGTTTGCTACCCATGGATACATGCTGGAAATGAAGGTTTATCATTTGCTTACCAGCTACT
GTATTTGCTGGATGCTACTGGATTTTACTCTCTAGGACTCCATGCCCTTGGCATTCATGTCTGTCGGGCTACAAGACAGGATCTGATGGA
X\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan