ESTScan Details for Unigene SGN-U217464

Score 
655
Direction 
Forward
Predicted Peptide Sequence 
ARGGILSLFAAQAGAKHVYAIEASEMADYARQLIAGNPSLNDRITVIKGKVEDVELPEKADILISEPMGTLLVNERMLESYVIARDRFLV
QNGKMFPGVGRIHMAPFSDEYLYMEIANKATFWQQQNYFGVDLTPLHGSAYQGYFSQPVVDAFDSRLLVAPAVSHVINFSSVKEEDLYEI
DVPLRFLSTVSTRIHGLACWFDVLFNGSTVQRWLTTAPGAQQLTGISFGGLTTTTLCHARTGDNWPASPSCPQGTKLYHLPDIAALVGDM
LQTSSVKLDLKEPYYRMSQPQSYSAAQDQNPSQLLQSDMQFPSRDDDGSILMQPPSPNELHSL
Predicted Coding Sequence 
GCACGAGGTGGCATTTTGTCATTATTTGCAGCTCAGGCTGGTGCAAAGCATGTATATGCCATAGAGGCTTCTGAAATGGCCGACTATGCA
AGACAACTTATTGCTGGAAATCCATCACTAAATGACAGAATTACAGTAATCAAAGGAAAGGTCGAAGATGTAGAGTTACCTGAGAAAGCT
GATATTTTAATCTCTGAGCCAATGGGTACCCTGTTAGTTAATGAAAGAATGTTGGAGTCTTATGTGATTGCAAGAGACCGATTTCTTGTT
CAAAATGGAAAAATGTTTCCTGGCGTTGGAAGAATACACATGGCACCATTTAGTGACGAATATTTGTATATGGAAATAGCAAATAAGGCT
ACCTTTTGGCAGCAGCAAAACTACTTTGGGGTTGATTTGACACCATTGCACGGATCTGCTTACCAAGGATACTTTTCTCAGCCAGTTGTT
GATGCTTTTGATTCTAGGTTATTGGTAGCTCCTGCAGTGTCCCATGTGATAAACTTCAGTTCGGTGAAGGAAGAAGATCTATATGAAATT
GACGTCCCGTTGAGGTTTCTCTCAACTGTTAGCACTAGAATTCATGGGCTGGCTTGCTGGTTTGATGTACTTTTTAATGGAAGCACTGTG
CAAAGGTGGCTGACCACTGCTCCGGGTGCACAACAACTCACTGGTATCAGCTTCGGTGGTCTTACCACAACCACTTTATGTCATGCCAGG
ACAGGAGATAACTGGCCGGCTTCACCTAGTTGCCCACAAGGCACAAAGTTATACCATTTACCTGACATTGCAGCTCTTGTTGGAGATATG
CTCCAAACATCATCTGTTAAACTTGATCTGAAGGAACCATATTACCGGATGTCCCAGCCCCAGTCATATTCAGCAGCACAGGATCAAAAT
CCTAGTCAGCTATTACAATCGGACATGCAATTTCCATCTCGAGATGACGACGGATCAATCCTAATGCAACCACCCTCCCCTAATGAGCTA
CATTCTCTTTGA\
Edits in Original Sequence 
(5')GCACGAGGTGGCATTTTGTCATTATTTGCAGCTCAGGCTGGTGCAAAGCATGTATATGCCATAGAGGCTTCTGAAATGGCCGACTA
TGCAAGACAACTTATTGCTGGAAATCCATCACTAAATGACAGAATTACAGTAATCAAAGGAAAGGTCGAAGATGTAGAGTTACCTGAGAA
AGCTGATATTTTAATCTCTGAGCCAATGGGTACCCTGTTAGTTAATGAAAGAATGTTGGAGTCTTATGTGATTGCAAGAGACCGATTTCT
TGTTCAAAATGGAAAAATGTTTCCTGGCGTTGGAAGAATACACATGGCACCATTTAGTGACGAATATTTGTATATGGAAATAGCAAATAA
GGCTACCTTTTGGCAGCAGCAAAACTACTTTGGGGTTGATTTGACACCATTGCACGGATCTGCTTACCAAGGATACTTTTCTCAGCCAGT
TGTTGATGCTTTTGATTCTAGGTTATTGGTAGCTCCTGCAGTGTCCCATGTGATAAACTTCAGTTCGGTGAAGGAAGAAGATCTATATGA
AATTGACGTCCCGTTGAGGTTTCTCTCAACTGTTAGCACTAGAATTCATGGGCTGGCTTGCTGGTTTGATGTACTTTTTAATGGAAGCAC
TGTGCAAAGGTGGCTGACCACTGCTCCGGGTGCAcCAACAACTCACTGGTATCAGCTTCGGTGtGTCTTACCACAACCACTTTATGTCAT
GCCAGGACAGGAGATAACTGGCCGGCTTCACCTAGTTGCCCACAAGGCACAAAGTTATACCATTTACCTGACATTGtCAGCTCTTGTTGG
AGATATGCTCCAAACATCATCTGTTAAACTTGATCTGAAGGAACCATATTACCGGATGTCCCAGCCCCAGTCATATTCAGCAGCACAGGA
TCAAAATCCTAGTCAGCTATTACAATCGGACATGCAATTTCCATCTCGAGATGACGACGGATCAATCCTAATGCAACCACCCTCCCCTAA
TGAGCTACATTCTCTTTGA\(3')TGTTAAAATTCAACTCCAAAGATGTGCATCGAAGACGAGCTTTTGCATATGTGATATGCATGAATG
TTTTAGTCTAATTTCCATCAAGTACATCTTTTTCTATTAACAGCTGCAGACTCCAGTGTTGAATGCTTACAAATTAAACTCTGAAATGAT
ATTAGTGGTGGCTATTTGACCTGTCCAAAAAAAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan