ESTScan Details for Unigene SGN-U217469

Score 
867
Direction 
Reverse
Predicted Peptide Sequence 
MNIGKILLSKRSVSGHNSSNISKKRKKKKKKMELEKRKSSREDMVQKLYDTCKQIFANGKAGYVPPPHDIQRLKSLLDSLEPKDFKFTAP
SLEFSSTNPPGTVEAPLVTYIKIHECNKFSIGIFCLPPSGVIPLHNHPGMTVFCKLLAGTMHTTSYDWVQNHNHQANHDRGQHESRMRLA
KVHVDDDFSAPCKSSVLFPESGGNMHCFKAITPCILLDVLGPPYSEAEGRHCTYYQHYSYDHISLSDVNKEMKEDEKRSYAWLEERKDEQ
FVVLGGTYDGPTIKL
Predicted Coding Sequence 
ATGAATATTGGGAAGATTTTGCTAAGTAAGAGAAGTGTATCAGGACATAATTCTTCTAATATATCGAAGAAGAGGAAAAAGAAGAAGAAG
AAGATGGAACTTGAAAAGAGAAAGAGTTCAAGGGAAGATATGGTTCAAAAGTTGTATGATACTTGCAAGCAAATATTTGCAAATGGTAAG
GCTGGCTATGTCCCTCCTCCTCATGACATCCAACGACTAAAATCCTTATTAGATAGTCTTGAACCAAAAGATTTCAAGTTTACAGCACCA
AGCTTGGAATTTTCAAGCACAAATCCTCCTGGAACCGTGGAAGCTCCTCTTGTTACCTACATTAAGATCCACGAATGCAACAAATTTTCG
ATTGGGATCTTCTGTTTGCCACCTTCAGGAGTAATCCCTCTTCATAATCATCCTGGCATGACTGTGTTCTGCAAGCTTCTAGCAGGAACC
ATGCACACCACGTCATATGATTGGGTGCAAAATCACAACCACCAGGCTAACCACGATCGCGGGCAACATGAATCTAGGATGAGGCTGGCA
AAAGTACATGTTGACGATGACTTCTCTGCACCATGCAAATCTTCAGTTCTATTTCCAGAATCAGGAGGAAACATGCATTGCTTCAAGGCA
ATAACACCATGTATCCTACTTGATGTTTTAGGACCACCATACTCTGAAGCTGAAGGCCGTCATTGCACATATTATCAACATTACTCGTAT
GATCACATAAGTTTATCCGATGTTAATAAAGAGATGAAGGAAGATGAGAAAAGATCATATGCATGGCTTGAAGAACGAAAAGATGAGCAG
TTTGTTGTGTTAGGAGGAACATATGATGGTCCTACAATCAAACTATGA\
Edits in Original Sequence 
AATTTTCAAATTTAATTTCTTTTGAGTTTCTCTCTGTGTGTTAATTAATTTTCCTGC(5')ATGAATATTGGGAAGATTTTGCTAAGTAA
GAGAAGTGTATCAGGACATAATTCTTCTAATATATCGAAGAAGAGGAAAAAGAAGAAGAAGAAGATGGAACTTGAAAAGAGAAAGAGTTC
AAGGGAAGATATGGTTCAAAAGTTGTATGATACTTGCAAGCAAATATTTGCAAATGGTAAGGCTGGCTATGTCCCTCCTCCTCATGACAT
CCAACGACTAAAATCCTTATTAGATAGTCTTGAACCAAAAGATTTCAAGTTTACAGCACCAAGCTTGGAATTTTCAAGCACAAATCCTCC
TGGAACCGTGGAAGCTCCTCTTGTTACCTACATTAAGATCCACGAATGCAACAAATTTTCGATTGGGATCTTCTGTTTGCCACCTTCAGG
AGTAATCCCTCTTCATAATCATCCTGGCATGACTGTGTTCTGCAAGCTTCTAGCAGGAACCATGCACACCACGTCATATGATTGGGTGCA
AAATCACAACCACCAGGCTAACCACGATCGCGGGCAACATGAATCTAGGATGAGGCTGGCAAAAGTACATGTTGACGATGACTTCTCTGC
ACCATGCAAATCTTCAGTTCTATTTCCAGAATCAGGAGGAAACATGCATTGCTTCAAGGCAATAACACCATGTATCCTACTTGATGTTTT
AGGACCACCATACTCTGAAGCTGAAGGCCGTCATTGCACATATTATCAACATTACTCGTATGATCACATAAGTTTATCCGATGTTAATAA
AGAGATGAAGGAAGATGAGAAAAGATCATATGCATGGCTTGAAGAACGAAAAGATGAGCAGTTTGTTGTGTTAGGAGGAACATATGATGG
TCCTACAATCAAACTATGA\(3')ATTGAAGACCATAGCAAATGTATATTATTAGAGTATTATTTTTGTATATTATTGTATTGAAATACA
TATAATATACAAATAGTGTATCTTTTTTATATATAGTTGGCTAGGCGAATGTAATTATTTTGGCCGGCCGACCAAATATGTAACTTTCCT
TATTTATAACTCTTTCAATTGATAGCCAAAATATCTTGTATTCCAATTGGTCTGTTCAGTTAAAGGAAAAAATGGCTGAAGTTTAATCAA
AAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan