ESTScan Details for Unigene SGN-U217540

Score 
396
Direction 
Forward
Predicted Peptide Sequence 
SMASLLNPPLTLPQNKLNPGGVLSVSTSGIPNKIFQPSSTRWSHRRRLMTRAKPSVEMDMLAKDSVGTDAVDDKDFGVVCMHHVGILCEN
LERSLDFYQNILGLEINEARPHDKLPYRGAWLWVGSEMIHLMELPNPDPYTGRPEHGGRDRHTCIAIRDVSKLKAILDKAGIPYTLVAXG
RPAIFTRDPDTNALEFTQVDA
Predicted Coding Sequence 
XXTTCAATGGCTTCTCTGCTGAACCCACCTCTCACTCTGCCTCAAAACAAGCTGAACCCTGGGGGTGTCTTATCTGTATCTACTAGTGGA
ATACCAAACAAAATTTTTCAACCATCTTCAACACGATGGAGCCACAGGCGGCGTTTGATGACGAGAGCTAAACCATCGGTGGAAATGGAT
ATGCTGGCAAAAGATTCTGTAGGCACCGACGCTGTTGATGATAAGGATTTTGGAGTTGTTTGCATGCACCACGTTGGGATACTATGTGAA
AACCTTGAGAGGTCCTTAGACTTTTACCAGAACATTCTTGGGCTAGAAATAAATGAGGCAAGACCACATGACAAACTTCCCTATAGAGGT
GCTTGGTTGTGGGTGGGTTCTGAGATGATACATCTAATGGAGCTTCCAAATCCAGATCCTTATACTGGTAGGCCTGAGCACGGGGGCAGA
GACCGTCATACTTGCATAGCAATTCGCGATGTGTCTAAGCTGAAAGCTATTCTTGATAAAGCTGGCATTCCCTACACTCTTGTCGCTXCT
GGGAGACCGGCCATTTTCACTCGAGACCCTGATACTAATGCACTAGAATTTACTCAAGTTGATGCTTGA\
Edits in Original Sequence 
(5')XXTTCAATGGCTTCTCTGCTGAACCCACCTCTCACTCTGCCTCAAAACAAGCTGAACCCTGGGGGTGTCTTATCTGTATCTACTAG
TGGAATACCAAACAAAATTTTTCAACCATCTTCAACACGATGGAGCCACAGGCGGCGTTTGATGACGAGAGCTAAACCATCGGTGGAAAT
GGATATGCTGGCAAAAGATTCTGTAGGCACCGACGCTGTTGATGATAAGGATTTTGGAGTTGTTTGCATGCACCACGTTGGGATACTATG
TGAAAACCTTGAGAGGTCCTTAGACTTTTACCAGAACATTCTTGGGCTAGAAATAAATGAGGCAAGACCACATGACAAACTTCCCTATAG
AGGTGCTTGGTTGTGGGTGGGTTCTGAGATGATACATCTAATGGAGCTTCCAAATCCAGATCCTTATACTGGTAGGCCTGAGCACGGGGG
CAGAGACCGTCATACTTGCATAGCAATTCGCGATGTGTCTAAGCTGAAAGCTATTCTTGATAAAGCTGGCATTCCCTACACTCTTaGTCG
CTXCTGGGAGACCGGCCATTTTCACTCGAGACCCTGATACTAATGCACTAGAATTTACTCAAGTTGATGCTTGA\(3')CAGGATCTGGA
CTGCTTGCTCTCCAATTTGTAATCCTTATATATAGTTAAATATACAGCTATTGTGAATATATATATATATAGGGGATATTCAACAAGTAG
AATCTATTGGA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan