ESTScan Details for Unigene SGN-U217612

Score 
716
Direction 
Forward
Predicted Peptide Sequence 
MAPICNLLLSEFSFKTIFPRNFVIRPDSKSVIYSPYHPAYSGSHTHKILSSTQKSYSSMAFAHCFLTVPADTTNFHTATSILTRPFSSSV
SSSFSSSNLKTCSLSNFHKNLRIGLKVSVKAQASEDSAAADAFTNFKHVLLPITDRNPYLSEGSRQAAATAAAMAKKYGADITVVVIDEK
GKEAYPEHETQLASIRWHLAEGGYQEFKLLERLGEGSKPTAIIGEIADDMNLDMVVMSMEAIHSKHVDANLLAEFIPCPVLLLPLXRRNV
SEKPVVLGFRIRDIXPFDTVLYFIDHELKFYICGKW
Predicted Coding Sequence 
ATGGCACCAATTTGTAACCTTTTGTTATCTGAATTTAGTTTTAAAACTATTTTTCCAAGAAATTTTGTGATTAGGCCCGACTCGAAATCX
GTGATATATAGTCCTTATCATCCTGCATATTCTGGAAGCCACACTCATAAAATCTTGTCGAGTACCCAGAAATCTTATTCATCCATGGCA
TTTGCTCACTGCTTCCTTACTGTCCCGGCTGATACTACAAACTTCCACACCGCTACTTCCATCCTTACCCGCCCCTTTTCATCTTCGGTG
AGTTCTTCTTTTTCTTCCTCAAACCTCAAAACTTGCAGCCTCTCTAATTTCCACAAGAATTTGAGAATCGGACTCAAAGTATCTGTTAAG
GCTCAAGCATCTGAAGACAGCGCAGCAGCAGATGCTTTCACCAACTTCAAGCATGTACTGTTACCAATTACAGACCGGAATCCTTATCTC
TCTGAGGGTTCAAGACAGGCTGCAGCAACTGCCGCTGCTATGGCAAAGAAGTATGGAGCTGATATAACAGTTGTTGTTATTGATGAAAAG
GGGAAAGAAGCATACCCAGAGCACGAGACACAACTAGCAAGCATCCGATGGCATTTAGCTGAAGGTGGATATCAAGAATTCAAGCTGTTA
GAGCGGCTAGGTGAAGGAAGCAAGCCAACAGCCATTATTGGTGAAATTGCTGATGATATGAACTTGGATATGGTAGTTATGAGCATGGAA
GCTATCCATTCCAAGCATGTAGATGCAAACCTTCTTGCTGAGTTCATCCCTTGCCCTGTATTGCTTTTGCCCCTATGAAGAAGAAATGTA
TCTGAAAAGCCAGTGGTGCTCGGTTTTAGGATCAGGGATATTAAXCCTTTTGATACTGTTCTCTACTTCATTGACCATGAACTCAAGTTT
TACATTTGTGGTAAGTGG\
Edits in Original Sequence 
ATAGACTAATTTTAAGAAAATCCTAAA(5')ATGGCACCAATTTGTAACCTTTTGTTATCTaGAATTTAGTTTTAAAACTATTTTTCCAA
GAAATTTTGTGATTAGGCCCGACTCGAAATCXGTGATATATAGTCCTTATCATCCTGCATATTCTGGAAGCCACACTCATAAAATCTTGT
CGAGTACCCAGAAATCTTATTCATCCATGGCATTTGCTCACTGCTTCCTTACTGTCCCGGCTGATACTACAAACTTCCACACCGCTACTT
CCATCCTTACCCGCCCCTTTTCATCTTCGGTGAGTTCTTCTTTTTCTTCCTCAAACCTCAAAACTTGCAGCCTCTCTAATTTCCACAAGA
ATTTGAGAATCGGACTCAAAGTATCTGTTAAGGCTCAAGCATCTGAAGACAGCGCAGCAGCAGATGCTTTCACCAACTTCAAGCATGTAC
TGTTACCAATTACAGACCGGAATCCTTATCTCTCTGAGGGTTCAAGACAGGCTGCAGCAACTGCCGCTGCTATGGCAAAGAAGTATGGAG
CTGATATAACAGTTGTTGTTATTGATGAAAAGGGGAAAGAAGCATACCCAGAGCACGAGACACAACTAGCAAGCATCCGATGGCATTTAG
CTGAAGGTGGATATCAAGAATTCAAGCTGTTAGAGCGGCTAGGTGAAGGAAGCAAGCCAACAGCCATTATTGGTGAAATTGCTGATGATA
TGAACTTGGATATGGTAGTTATGAGCATGGAAGCTATCCATTCCAAGCATGTAGATGCAAACCTTCTTGCTGAGTTCATCCCTTGCCCTG
TATTGCTTTTGCCCCTATGAAGAAGAAATGTATCTGAAAAGCCAGTGGTGCTCGGTTTTAGGATCAGGGATATTAAXCCTTTTGATACTG
TTCTCTACTTCATTGACCATGAACTCAAGTTTTACATTTGTGGTAAGTGG\(3')TAATAGAACAGAACAAACAAGCTGGTTCATTGCTA
TTTGCTTCTTAATCATGTGGAGAGATATGAATATGTTGTTTACTCTTTGAAGTAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan