ESTScan Details for Unigene SGN-U217629

Score 
557
Direction 
Forward
Predicted Peptide Sequence 
KTLNPSNTPQRHFQLRSFFNGVRRFQKSQFEARVVTLSSNLLVLRGGSVSTQFLLSETKNGNDTSSLSNPWWRSMATFTRTKPHVNVGTI
GHVDHGKTTLTAAITKVLAEEGKAKAIAFDEIDKAPEEKKRGITIATAHVEYETAKRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSA
PDGPMPQTKEHILLARQVGVPSLVCFLNKVDAVDDP
Predicted Coding Sequence 
AAAACXCTAAACCCTTCAAATACCCCTCAACGCCATTTCCAGCTTCGTAGCTTCTTCAATGGCGTCCGTCGTTTTCAGAAATCCCAATTC
GAAGCGCGTGTTGTCACTCTCTCCTCAAATCTACTCGTGTTGAGAGGAGGATCAGTTTCCACTCAGTTTTTGCTCTCCGAAACGAAAAAT
GGAAATGATACTTCCAGTCTTTCTAATCCATGGTGGAGATCTATGGCCACCTTCACTCGAACAAAACCTCATGTAAATGTGGGAACTATA
GGACACGTTGATCATGGAAAGACTACTCTTACTGCTGCAATTACAAAGGTTCTAGCAGAAGAAGGAAAGGCCAAGGCAATTGCATTTGAT
GAAATTGACAAAGCCCCTGAAGAGAAGAAGAGAGGAATTACTATTGCTACAGCCCACGTGGAGTATGAGACAGCTAAAAGACATTATGCT
CATGTTGACTGCCCAGGACACGCGGATTACGTTAAAAATATGATTACCGGAGCTGCCCAAATGGATGGTGGTATTCTAGTTGTATCTGCT
CCAGATGGACCTATGCCGCAAACAAAGGAGCATATTCTTCTTGCCCGCCAGGTCGGTGTGCCCTCTCTTGTCTGCTTTTTAAACAAAGTT
GATGCTGTTGACGATCCT\
Edits in Original Sequence 
(5')AAAACXCTAAACCCTTCAAATACCCCTCAACGCCATTTCCAGCTTCGTAGCTTCTTCAATGGCGTCCGTCGTTTTCAGAAATCCCA
ATTCGAAGCGCGTGTTGTCACTCTCTCCTCAAATCTACTCGTGTTGtAGAGGAGGATCAGTTTCCACTCAGTTTTTGCTCTCCGAAACGA
AAAATGGAAATGATACTTCCAGTCTTTCTAATCCATGGTGGAGATCTATGGCCACCTTCACTCGAACAAAACCTCATGTAAATGTGGGAA
CTATAGGACACGTTGATCATGGAAAGACTACTCTTACTGCTGCAATTACAAAGGTTCTAGCAGAAGAAGGAAAGGCCAAGGCAATTGCAT
TTGATGAAATTGACAAAGCCCCTGAAGAGAAGAAGAGAGGAATTACTATTGCTACAGCCCACGTGGAGTATGAGACAGCTAAAAGACATT
ATGCTCATGTTGACTGCCCAGGACACGCGGATTACGTTAAAAATATGATTACCGGAGCTGCCCAAATGGATGGTGGTATTCTAGTTGTAT
CTGCTCCAGATGGACCTATGCCGCAAACAAAGGAGCATATTCTTCTTGCCCGCCAGGTCGGTGTGCCCTCTCTTGTCTGCTTTTTAAACA
AAGTTGATGCTGTTGACGATCCT\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan