ESTScan Details for Unigene SGN-U217725

Score 
858
Direction 
Forward
Predicted Peptide Sequence 
EFTGDCEEEKNFSSGELILHCLRLLHPMFPIIISQSVDLDGHFLIGATPEKPNNQFQLLMEQADNRSNDEHVIDITSSNDASSSSNPHDR
PVNNVLHVQAEHPPSTSTTVPVSQHAFSSASRSNLRNSSFAEEEVGAAIGXPLNSVLWISIELVLTLSQIIAAIAVLAISRDEHPRAPLA
QWIVGYASGCVAILPLLYWRFRHRNQNSDQDSSQQPQISSQVELSARPSSSTRSSEGEGRQTTATASTGGQSNEILSTRIKSFVEYFKMA
LDCFFAVWFVVGNVWIFGGHSSSSEAPNLYRLCIVFLTFSCIGYAMPFILVQQYAAASPALFQSWASEKXLTQNKGATPESINALPTYKF
KVKKNKSGNKEAAEGGVVAAGTDKERVISGEDAACCICLAKYVNNDELRELPCSHFFHKDCVDKWLKINNSCPLCKAEVGETLLSSLTEA
TASLLRVPRFKLRLCPHASXRDAF
Predicted Coding Sequence 
XCTGAATTTACTGGTGATTGTGAAGAGGAGAAGAATTTTTCATCTGGTGAACTCATACTTCACTGCTTAAGACTTTTGCATCCCATGTTT
CCTATAATTATCTCTCAGTCAGTGGACTTAGATGGCCATTTCCTCATTGGGGCTACACCGGAAAAGCCAAACAACCAGTTTCAATTATTA
ATGGAGCAAGCAGATAACCGTAGCAACGATGAGCATGTAATTGACATAACTAGTAGCAATGATGCATCCTCATCAAGCAACCCCCATGAT
AGACCAGTTAATAATGTGCTTCATGTCCAAGCTGAACATCCCCCATCAACAAGCACAACAGTGCCCGTCTCCCAACATGCATTTTCTTCT
GCTAGTAGATCCAACTTGAGGAACTCATCATTTGCTGAAGAGGAAGTGGGCGCCGCCATCGGAGXTCCTCTGAATTCTGTGCTCTGGATA
TCCATTGAACTAGTCTTGACATTGAGCCAAATAATTGCAGCAATCGCGGTGTTGGCCATATCAAGGGATGAGCACCCACGAGCTCCTCTA
GCCCAATGGATAGTTGGTTATGCATCTGGGTGTGTAGCAATTCTCCCTCTTCTCTACTGGCGTTTTCGTCATAGAAACCAAAATTCAGAT
CAGGATTCATCTCAGCAGCCACAGATTTCTTCCCAGGTTGAACTCTCAGCCAGACCATCCTCAAGTACAAGGAGTTCAGAAGGTGAAGGT
CGTCAGACAACTGCTACAGCTTCTACAGGTGGTCAAAGTAATGAAATACTGAGCACAAGGATAAAATCATTTGTTGAGTACTTCAAAATG
GCATTAGATTGTTTTTTTGCAGTGTGGTTTGTGGTTGGAAATGTGTGGATATTTGGCGGACACTCCTCTTCCTCTGAGGCTCCCAACTTG
TACAGGTTGTGTATAGTATTTCTGACCTTTAGCTGTATCGGGTATGCCATGCCATTTATTCTTGTGCAACAATATGCTGCTGCCTCCCCT
GCATTATTTCAGTCATGGGCTTCCGAGAAGATXCTGACTCAAAACAAAGGCGCCACACCAGAATCAATTAATGCTCTTCCGACCTATAAA
TTTAAGGTAAAGAAAAACAAAAGTGGCAACAAAGAGGCTGCTGAAGGTGGGGTTGTGGCTGCAGGAACGGACAAGGAGCGTGTGATTTCA
GGAGAAGATGCGGCATGTTGCATTTGCTTAGCAAAGTATGTGAACAATGATGAGCTAAGGGAGTTACCCTGTTCTCATTTCTTCCACAAG
GACTGTGTTGATAAGTGGCTGAAAATCAACAACTCATGTCCCCTTTGCAAAGCTGAGGTGGGTGAGACCCTTTTGAGCTCTCTAACGGAA
GCAACTGCAAGTTTGCTCAGAGTTCCGCGTTTTAAGTTACGACTCTGCCCACATGCTAGTXATAGAGATGCTTTTTAA\
Edits in Original Sequence 
(5')XCTGAATTTACTgGGTGATTGTGAAGAGGAGAAGAATTTTTCATCTGGTGAACTCATACTTCACTGCTTAAGACTTTTGCATCCCA
TGTTTCCTATAATTATCTCTCAGTCAGTGGACTTAGATGGCCATTTCCTCATTGGGGCTACACCGGAAAAGCCAAACtAACCAGTTTCAA
TTATTAATGGAGCAAGCAGATAACCGTAGCAACGATGAGCATGTAATTGACATAACTAGTAGCAATGATGCATCCTCATCAAGCAACCCC
CATGATAGACCAGTTAATAATGTGCTTCATGTCCAAGCTGAACATCCCCCATCAACAAGCACAACAGTGCCCGTCTCCCAACATGCATTT
TCTTCTGCTAGTAGATCCAACTTGAGGAACTCATCATTTGCTcGAAGAGGAAGTGGGCGCCGCCATCGGAGXTCCTCTGAATTCTGTGCT
CTGGATATCCATTGAACTAGTCTTGACATTGAGCCAAATAATTGCAGCAATCGCGGTGTTGGCCATATCAAGGGATGAGCACCCACGAGC
TCCTCTAGCCCAATGGATAGTTGGTTATGCATCTGGGTGTGTAGCAATTCTCCCTCTTCTCTACTGGCGTTTTCGTCATAGAAACCAAAA
TTCAGATCAGGATTCATCTCAGCAGCCACAGATTTCTTCCCAGGTTGAACTCTCAGCCAGACCATCCTCAAGTACAAGGAGTTCAGAAGG
TGAAGGTCGTCAGACAACTGCTACAGCTTCTACAGGTGGTCAAAGTAATGAAATACTGAGCACAAGGATAAAATCATTTGTTGAGTACTT
CAAAATGGCATTAGATTGTTTTTTTGCAGTGTGGTTTGTGGTTGGAAATGTGTGGATATTTGGCGGACACTCCTCTTCCTCTGAGGCTCC
CAACTTGTACAGGTTGTGTATAGTATTTCTGACCTTTAGCTGTATCGGGTATGCCATGCCATTTATTCTaTGTGCAACAATATGCTGCTG
CCTCCCCTGCATTATTTCAGTCATGGGCTTCCGAGAAGATXCTGACTCAAAACAAAGGCGCCACACCAGAATCAATTAATGCTCTTCCGA
CCTATAAATTTAAGGTAAAGAAAAACAAAAGTGGCAACAAAGAGGCTGCTGAAGGTGGGGTTGTGGCTGCAGGAACGGACAAGGAGCGTG
TGATTTCAGGAGAAGATGCGGCATGTTGCATTTGCTTAGCAAAGTATGTGAACAATGATGAGCTAAGGGAGTTACCCTGTTCTCATTTCT
TCCACAAGGACTGTGTTGATAAGTGGCTGAAAATCAACAACTCATGTCCCCTTTGCAAAGCTGAGGTGGGTGAGACCCTTTTGAGCTCTC
TAACGGAAGCAACTGCAAGTTTGCgTCAGAGTTCCGCGTTTTAAGTTACGACTCTGCCCACATGCTAGTXATAGAGATGCTTTTTAA\(3')
AGGAATAGTAGTTACCTTCATATATATTTTATTTTCTTCCATCACTCTTCTGATTTTCTTTTTGGCTAATGTTGTTAGCTTGCTAGAT
TTATATACAATTTCTGT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan