ESTScan Details for Unigene SGN-U217788

Score 
472
Direction 
Forward
Predicted Peptide Sequence 
ETESETESESELREKATMEAGDEALEMVVDSKDLQQQSKALDKLTDHVEDRQLDSSRVQTAMASIYASKEADLQAMRLREKELAAVKINA
ADIDIIANELEVDKKVAERTLREHKGDAVAAXKAFAQLVSNYNASVSNKLGSAI
Predicted Coding Sequence 
XXTGAAACTGAATCGGAAACGGAATCGGAATCGGAGCTCAGAGAGAAAGCAACAATGGAGGCCGGAGACGAAGCGCTTGAGATGGTGGTA
GACTCAAAGGACTTGCAGCAGCAAAGCAAAGCTCTAGATAAGCTCACTGACCATGTCGAAGATCGTCAGCTTGATTCCTCTCGTGTTCAA
ACGGCTATGGCTTCAATTTATGCATCTAAGGAAGCTGATCTTCAGGCTATGAGACTGAGGGAGAAAGAACTAGCTGCTGTTAAGATTAAT
GCTGCTGATATTGATATAATTGCAAACGAACTAGAGGTGGACAAGAAGGTTGCTGAAAGGACTTTGAGAGAGCATAAAGGTGATGCTGTA
GCTGCAGXTAAGGCATTTGCTCAACTAGTCAGTAACTACAACGCCTCAGTCTCAAACAAATTGGGGTCGGCTATATGA\
Edits in Original Sequence 
(5')XXTGAAACTGAATCGGAAACGGAATCGGAATCGGAGCTCAGAGAGAAAGCAACAATGGAGGCCGGAGACGAAGCGCTTGAGATGGT
GGTAGACTCAAAGGACTTGCAGCAGCAAAGCAAAGCTCTAGATAAGCTCACTGACCATGTCGAAGATCGTCAGCTTGATTCCTCTCGTGT
TCAAACGGCTATGGCTTCAATTTATGCATCTAAGGAAGCTGATCTTCAGGCTATGAGACTGAGGGAGAAAGAACTAGCTGCTGTTAAGAT
TAATGCTGCTGATATTGATATAATTGCAAACGAACTAGAGGTGGACAAGAAGGTTGCTGAAAGGACTTTGAGAGAGCATAAAGGTGATGC
TGTAGCTGCAGXTAAGGCATTTGCTCAACTAGTaCAGTAACTACAACGCCTCAGTCTCAAACAAATTGGGGTCGGCTATATGA\(3')AC
TGTCGGGGATCTTTTTCATTGATTCTGAAATGTTCTAGCAAAGTGACTACTAAATGTTCATGCTATATATGTAACTTTGATCTGTTGACA
CTTTTTTTCAATTATATTGGTAATTGATAAGAGTGAAAAAAAAAAAAAAAAAAAAAAAAAACT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan