ESTScan Details for Unigene SGN-U217905

Score 
342
Direction 
Forward
Predicted Peptide Sequence 
MPIISTTSPRSFLQTPPPPVNIFSSGDNSLLSPSSVRFRQSGNFTTAAAAAATCASVETESTTSRYSTLPSDIIHASSASFYEILGIPIG
ATIQEIKAAYRRLARVCHPDVAAIDQKDTSADDFMKIHSAYSTLSDPDKRADYDRRYSGGAGTSIYTPAAVLLQQCRHSPAILPGTGKQI
SAGALSII
Predicted Coding Sequence 
ATGCCCATCATATCTACTACTTCCCCTCGTTCGTTTCTTCAAACTCCGCCACCGCCGGTGAATATATTTTCCTCCGGCGATAATTCTCTT
CTATCACCGTCTTCCGTCAGATTCCGTCAGTCCGGTAACTTCACCACCGCCGCAGCGGCGGCGGCGACTTGCGCTTCCGTCGAAACTGAA
TCTACCACGTCAAGGTACTCGACGCTGCCTTCTGACATTATCCATGCTTCTTCGGCGTCTTTCTACGAGATTCTAGGGATTCCGATCGGC
GCTACGATCCAGGAGATCAAGGCAGCTTATCGGAGATTAGCTAGGGTTTGTCATCCTGATGTGGCGGCAATTGATCAGAAGGACACGTCG
GCGGACGATTTCATGAAGATTCATTCTGCCTATTCTACTCTTTCGGATCCGGATAAACGCGCCGATTATGACCGCCGCTATTCCGGAGGC
GCCGGAACGTCAATTTATACTCCGGCGGCTGTTCTCCTTCAGCAATGTCGGCATTCACCGGCTATACTACCCGGAACTGGGAAACAGATC
AGTGCTGGTGCTCTCTCCATCATTTAA\
Edits in Original Sequence 
ACACTCAACGCACACACACACACACACACCAAAAAGTAAAATAAAC(5')ATGCCCATCATATCTACTACTTCCCCTCGTTCGTTTCTTC
AAACTCCGCCACCGCCGGTGAATATATTTTCCTCCGGCGATAATTCTCTTCTATCACCGTCTTCCGTCAGATTCCGTCAGTCCGGTAACT
TCACCACCGCCGCAGCGGCGGCGGCGACTTGCGCTTCCGTCGAAACTGAATCTACCACGTCAAGGTACTCGACGCTGCCTTCTGACATTA
TCCATGCTTCTTCGGCGTCTTTCTACGAGATTCTAGGGATTCCGATCGGCGCTACGATCCAGGAGATCAAGGCAGCTTATCGGAGATTAG
CTAGGGTTTGTCATCCTGATGTGGCGGCAATTGATCAGAAGGACACGTCGGCGGACGATTTCATGAAGATTCATTCTGCCTATTCTACTC
TTTCGGATCCGGATAAACGCGCCGATTATGACCGCCGcCTATTCCGGAGGCGCCGGAACGTCAATTTATACTCCGGCGGCTGTTCTCCTT
CAGCAATGTCGGCATTCACCGGCTATACTACCCGGAACTGGGAAACAGATCAGTGCTGGTaGCTCTCTCCATCATTTAA\(3')AGCCTG
TTGTATATTTTTCTGAGGCATAGTGGGAAAGAGATTTTTTAAACGAAAAAAAAAATTAACTTAGATTTGCTATCTTTACTGGTATCTTAT
TAGAGTTTCTACTTGTATATGCTGATTAATACTGACATGA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan