ESTScan Details for Unigene SGN-U217973

Score 
1014
Direction 
Forward
Predicted Peptide Sequence 
GGETKRHISVDXEELTTITQEFPHFPPPIATVNSKKLSLREQKWVVHELVAVGVGGIVVAGMAILVAFQEKLVYVPVLPGLTKAYPITPA
RLRLLYEDVWLRSSDGVRLHAWFIKLFPDCRGPTIIFFQENAGNIAHRLEMVRIMLQRLQCNVFMLSYRGYGASDGYPSQHGITKDAQAA
LDHLVQRTDIDTSRIVVFGRSLGGAVGTVLTKNNPDKVAGLILENTFTSILDMAGVLLPFLKWVIGGSGSKGFKLLNFVVRSPWNTIDVI
GEIRQPILFLSGLQDEMVPPFHMQMLYAKAAARNRQCLFVEFPSGMHMDTWLAGGDHYWRTIQKYLEETVPEKKDDESKKDSELSSKQNV
SSDFAAAEMLSFRQFKCNFGFEDSNTFLLSCSDEEQFVISREWKCILSNIYSSDDIXLVSYFQKEKDVKGLDLYCISLTILGCRNIGPAX
Predicted Coding Sequence 
GGTGGTGAAACAAAAAGGCATATCAGTGTAGACAXTGAGGAGTTAACAACCATTACACAAGAATTTCCTCATTTTCCTCCTCCAATTGCT
ACTGTCAATTCAAAAAAGCTTAGCTTGAGGGAACAGAAATGGGTCGTACATGAGCTTGTTGCTGTCGGAGTGGGAGGAATAGTGGTCGCC
GGGATGGCAATACTGGTCGCCTTTCAGGAAAAACTTGTATATGTTCCCGTCTTACCTGGACTCACTAAGGCATATCCAATTACTCCCGCT
CGACTTCGACTCCTTTACGAAGATGTTTGGCTCAGATCTTCAGACGGTGTTCGTCTTCATGCTTGGTTCATCAAACTCTTCCCTGACTGC
AGAGGTCCTACTATCATCTTTTTTCAAGAGAATGCAGGAAATATTGCACATCGTCTTGAAATGGTTCGCATAATGTTACAACGTTTGCAA
TGCAATGTTTTTATGCTTTCTTATCGAGGTTACGGAGCCAGTGATGGATACCCTTCTCAACATGGAATCACAAAGGATGCTCAGGCTGCA
CTGGATCATTTAGTTCAGAGGACCGATATTGACACATCAAGAATAGTAGTCTTTGGAAGGTCACTTGGAGGAGCTGTTGGCACTGTTCTT
ACCAAAAACAATCCTGACAAGGTAGCTGGGCTCATTTTGGAGAATACTTTCACCTCTATCCTGGATATGGCAGGAGTTCTCTTGCCATTC
TTGAAGTGGGTCATTGGTGGCAGTGGCTCAAAGGGTTTCAAGCTTCTTAACTTTGTTGTTCGATCTCCATGGAATACCATTGATGTCATT
GGTGAGATCAGGCAACCAATCCTCTTCCTATCTGGATTACAAGATGAGATGGTTCCACCATTCCACATGCAGATGCTGTATGCAAAGGCA
GCGGCACGTAACAGGCAATGCTTATTTGTGGAATTTCCTAGTGGGATGCACATGGATACCTGGTTGGCAGGTGGTGATCATTATTGGAGG
ACAATTCAGAAATATTTGGAAGAAACTGTCCCAGAGAAGAAGGATGATGAATCAAAGAAGGATTCCGAACTGTCCTCTAAGCAAAATGTA
TCTTCAGATTTCGCTGCAGCTGAAATGTTGAGTTTCAGGCAGTTCAAATGTAACTTTGGATTCGAGGATTCAAATACATTTCTTTTGAGT
TGCAGTGATGAAGAGCAGTTTGTGATATCAAGGGAATGGAAGTGCATCCTTTCAAATATTTATTCTTCTGATGATATTXTTTTGGTGTCC
TATTTTCAGAAGGAAAAAGATGTGAAGGGTCTTGATTTATACTGCATCTCACTAACAATACTAGGGTGTCGAAATATAGGTCCAGCTGXX
\
Edits in Original Sequence 
(5')GGTGGTGAAACAAAAAGGCATATCAGTGTAGACAXTGAGGAGTTAACAACCATTACACAAGAATTTCaCTCATTTTCCTCCTCCAA
TTGCTACTGTCAATTCAAAAAAGCTTAGCTTGAGGGAACAGAAATGGtGTCGTACATGAGCTTGTTGCTGTaCGGAGTGGGAGGAATAGT
GGTCGCCGGGATGGCAATACTGGTCGCCTTTCAGGAAAAACTTGTATATGTTCCCGTCTTACCTGGACTCACTAAGGCATATCCAATTAC
TCCCGCTCGACTTCGACTCCTTTACGAAGATGTTTGGCTCAGATCTTCAGACGGTGTTCGTCTTCATGCTTGGTTCATCAAACTCTTCCC
TGACTGCAGAGGTCCTACTATCATCTTTTTTCAAGAGAATGCAGGAAATATTGCACATCGTCTTGAAATGGTTCGCATAATGTTACAACG
TTTGCAATGCAATGTTTTTATGCTTTCTTATCGAGGTTACGGAGCCAGTGATGGATACCCTTCTCAACATGGAATCACAAAGGATGCTCA
GGCTGCACTGGATCATTTAGTTCAGAGGACCGATATTGACACATCAAGAATAGTAGTCTTTGGAAGGTCACTTGGAGGAGCTGTTGGCAC
TGTTCTTACCAAAAACAATCCTGACAAGGTAGCTGGGCTCATTTTGGAGAATACTTTCACCTCTATCCTGGATATGGCAGGAGTTCTCTT
GCCATTCTTGAAGTGGGTCATTGGTGGCAGTGGCTCAAAGGGTTTCAAGCTTCTTAACTTTGTTGTTCGATCTCCATGGAATACCATTGA
TGTCATTGGTGAGATCAGGCAACCAATCCTCTTCCTATCTGGATTACAAGATGAGATGGTTCCACCATTCCACATGCAGATGCTGTATGC
AAAGGCAGCGGCACGTAACAGGCAATGCTTATTTGTGGAATTTCCTAGTGGGATGCACATGGATACCTGGTTGGCAGGTGGTGATCATTA
TTGGAGGACAATTCAGAAATATTTGGAAGAAACTGTCCCAGAGAAGAAGGATGATGAATCAAAGAAGGATTCCGAACTGTCCTCTAAGCA
AAATGTATCTTCAGATTTCGCTGCaAGCTGAAATGTTGAGTTTCAGGCAGTTCAAATGTAACTTTGGATTCGAGGATTCAAATACATTTC
TTTTGAtGTTGCAGTGATGAAGAGCAGTTTGTGATATCAAGGGAATGGAAGTGCATCCTTTCAAATATTTATTCTTCTGATGATATTXTT
TTGGTGTCCTATTTTCAGAAGGtAAAAAGATGTGAAGGGTCTTGATTTATACTGCATCTCACTAACAATACTAGGGTGTCGAAATATAGG
TCCAGCTGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan