ESTScan Details for Unigene SGN-U218046

Score 
187
Direction 
Reverse
Predicted Peptide Sequence 
LRRVAGFRTVPVEVGKNYLCPEWKQELITFSEFLERIRSNDTTSVETTYLAQHQLFDQWLSSVANDRYKXLQQDIVIPDYCFTGGGEIRS
LNAWFGPAGTVTPLHHDPHHNILAQVVGKKYVRLYSASLSDELHPHSETMLSNSSQVDLDNIDEKEFPNILDLEFQDCILEEGEMLYIPP
KWWPYSAFSRQAFQLAFGGXDAEKLDD
Predicted Coding Sequence 
XXTCTTAGAAGGGTTGCTGGCTTCCGTACAGTCCCGGTTGAGGTCGGAAAGAACTATTTGTGCCCAGAATGGAAGCAAGAGCTGATCACT
TTTTCTGAATTTCTTGAGAGGATACGGTCCAATGATACTACCTCTGTGGAAACTACGTACTTAGCTCAGCATCAATTATTTGATCAGTGG
CTTAGCTCTGTAGCAAATGACAGATACAAGAXGCTACAACAAGATATTGTTATTCCTGATTATTGTTTTACTGGAGGTGGGGAAATTAGG
TCGCTTAATGCTTGGTTTGGTCCAGCCGGGACTGTGACGCCTTTGCATCATGATCCGCACCATAACATACTTGCTCAGGTTGTTGGCAAA
AAGTATGTACGGCTTTACTCTGCATCACTTTCGGATGAGCTTCACCCACATAGTGAAACCATGCTTAGTAATTCCAGCCAGGTTGATTTA
GACAACATTGACGAGAAAGAGTTCCCAAATATATTAGACCTCGAATTCCAGGACTGTATTTTAGAGGAAGGTGAAATGCTTTACATCCCC
CCTAAATGGTGGCCCTACTCCGCTTTCTCCCGACAAGCTTTTCAGTTAGCTTTTGGTGGAGXTGATGCTGAAAAATTAGACGACTGA\
Edits in Original Sequence 
(5')XXTCTTAGAAGGGTTGCTGGCTTCCGTACAGTCCCGGTTGAGGTCGGAAAGAACTATTTGTGCCCAGAATGGAAGCAAGAGCTGAT
CACTTTTTCTGAATTTCTTGAGAGGATACGGTCCAATGATACTACCTCTGTGGAAACTACGTACTTAGCTCAGCATCAATTATTTGATCA
GTGGCTTAGCTCTGTAGCtAAATGACAGATACAAGAXGCTACAACAAGATATTGTTATTCCTGATTATTGTTTTACTGGAGGTGGGGAAA
TTAGGTCGCTTAATGCTTGGTTTGGTCCAGCCGGGACTGTGACGCCTTTGCATCATGATCCGCACCATAACATACTTGCTCAGGTTGTTG
GCAAAAAGTATGTACGGCTTTACTCTGCATCACTTTCGGATGAGCTTCACCCACATAGTGAAACCATGCTTAGTAATTCCAGCCAGGTTG
ATTTAGACAACATTGACGAGAAAGAGTTCCCAAATATATTAGACCTCGAATTCCAGGACTGTATTTTAGAGGAAGGTGAAATGCTTTACA
TCCCCCCTAAATGGTGGCCCTACgTCCGCTTTCTCCCGACAAGCTTTTCAGTTAGCTTTTGGTGGAGXTGATGCTGAAAAATTAGACGAC
TGA\(3')TCGGTTTTGTTTCGTTTATACAAAGGGAACCCGTCCAACCCTCATTTTTTTGCAAATAGCCTTGTTGTCTTTGAGACTTGTG
ATGATGAATTTCCAAAGAGTGGCAATCTTGCTTTATTACTTAAAGGTTTGTTTAATCATTATCATGAATTTAGTAAATAAGGTGAAAATG
AAATTTTACTTATTTGGAACTGAGTTATAGTTATTGTTGTAGGATTTCCCGAGATGAAATGACAAAAAGGTTTTGGAAAAAAAAAAAAAA
AAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan