ESTScan Details for Unigene SGN-U218063

Score 
477
Direction 
Reverse
Predicted Peptide Sequence 
FLPEEKVESINGLTLTADGKGAVFDVAAEHLDEFLSGQKTAHGVNIEVVEALPPLQEREKPRGGRFGGGGRGGGFGKEEAEVAFLEEEGG
EVMATLVADGKEWRHNFFDS
Predicted Coding Sequence 
TTCTTGCCTGAGGAGAAGGTTGAATCAATCAATGGTCTTACTTTGACAGCTGATGGAAAGGGGGCAGTTTTTGATGTTGCTGCTGAGCAC
TTGGATGAATTTCTCTCAGGCCAAAAAACTGCACATGGGGTAAATATAGAGGTTGTGGAAGCGCTGCCTCCTTTGCAAGAGAGAGAGAAG
CCAAGAGGTGGAAGATTTGGAGGTGGTGGCCGTGGCGGCGGCTTCGGTAAAGAAGAGGCGGAGGTGGCTTTTCTGGAGGAAGAGGGGGGA
GAGGTAATGGCAACTTTGGTCGCAGATGGTAAGGAATGGCGACATAATTTTTTTGATAGCTGA\
Edits in Original Sequence 
(5')TTCTTGCCTGAGGAGAAGGTTGAATCAATCAATGGTCTTACTTTGACAGCTGATGGAAAGGGGGCAGTTTTTGATGTTGCTGCTGA
GCACTTGGATGAATTTCTCTCAGGCCAAAAAACTGCACATGGGGTAAATATAGAGGTTGTGGAAGCGCTGCCTCCTTTGCAAGAGAGAGA
GAAGCCAAGAGGTGGAAGATTTGGAGGTGGTGGCCGTGGCGGCGGCTTCGGTAAcAGAAGAGGCGGAGGTGGCTTTTCTGGAGGAAGAGG
GGGGAGAGGTAATGGCAACTTTGGTCGCAGATGGTAAGGAATGGCGACATAATTTTTTTGATAGCTGA\(3')CAATACAAGAGTTTGTC
CAAGGCTGCGTTCAAAATTTTGGTATAGTGAAGAAAATGTATGGGACTTCAGTAAGGTTTCTTCTGTATTAATTTTACTAATTTATATAG
GTTTCTCCTCCCTGTACCCTGCTTCATTATGCTTTTCGCTAGTTAGCTTTCTTGTAGTGTTCTTCCATGTTTTACTATATTTTTGGTTAG
ACACTTGAAAAGTTATTATTTATTTTGTATGGTATTGTTACCTGAAGAAATCATATTCAATTCAAGTTCAATTTACTAAAAAAAAAAAAA
AAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan