ESTScan Details for Unigene SGN-U218149

Score 
787
Direction 
Forward
Predicted Peptide Sequence 
APSASESVFRIKWAPSSPQRSSSDLQILQSPTDEQLLNLSTQDLGFSSFSPSSEKISGSRSSRVLQIQSGFLNADVKFSMFMIIVEHRXD
LISDRFVSVLKIIICGDYYXKMPVKVASASLRDRTQEFQSIAERLKKSFSSVQNGSISTSTSSGSRSEEQRTTIAMQSEFNRRASKIGFG
IHQTSQKLAKLAKLAKRTSVFDDPTTEIQELTAVIKQDITALNSAVVDLQLHSNARNESGNSDTTSHSTTVVDDLKNRLMTATKEFKEVL
TMRTENMKVHENRRQMFSSSTSKEASNPFMRQRPLASRNTASTSASPPPWANDSPSSSQLFPRKQGDGDTQPLLQDQQQQQQQQIVPLQD
SYMQSRAEALQNVESTIHELGSIFNQLATLVSQQGEVAIRIDENMDDTLTNVEGAQGALLKYLNSISSNRWLMIKIFFXVDFLPYDFPIF
RGIVNNGDIRQSVM
Predicted Coding Sequence 
GCACCGTCAGCTTCTGAATCXGTTTTTCGGATCAAATGGGCTCCTTCCTCCCCTCAACGTTCCTCATCTGATCTGCAAATCCTTCAATCC
CCTACAGATGAACAATTACTTAATCTCTCTACGCAAGATCTAGGGTTTTCATCATTCTCACCTTCGTCGGAGAAGATTTCTGGATCTCGC
AGTTCTAGGGTTCTTCAGATCCAATCXGGTTTTTTGAATGCGGATGTGAAATTCTCTATGTTTATGATAATCGTGGAGCATAGAXTCGAC
TTGATATCGGATCGATTTGTTAGTGTATTGAAAATTATAATTTGCGGAGATTATTATXTGAAAATGCCTGTGAAAGTAGCAAGTGCGTCA
TTACGGGATCGGACTCAGGAGTTTCAGAGTATAGCGGAGAGGTTAAAGAAGTCATTTTCGTCGGTTCAGAATGGGTCGATTAGCACCAGC
ACCAGCAGTGGTTCTAGATCGGAGGAACAGAGGACCACTATTGCTATGCAATCGGAGTTCAATCGGCGAGCCTCCAAAATTGGTTTTGGA
ATACATCAAACTTCTCAGAAGCTTGCAAAGCTAGCAAAGTTGGCAAAAAGGACTTCCGTTTTTGATGATCCGACTACGGAAATCCAAGAG
TTGACTGCAGTCATCAAGCAAGATATTACAGCACTTAACTCTGCTGTAGTAGATCTCCAGCTTCACTCTAATGCTCGTAATGAAAGTGGT
AATAGTGATACCACTAGTCACTCGACGACTGTTGTAGATGACTTGAAGAACAGGCTGATGACTGCCACAAAGGAGTTCAAAGAAGTACTC
ACCATGCGGACAGAGAATATGAAGGTTCATGAGAACAGAAGACAGATGTTTTCTTCATCGACTAGCAAAGAAGCTTCAAATCCATTTATG
CGCCAACGTCCACTAGCTTCAAGGAATACTGCTAGTACATCAGCCAGCCCTCCTCCTTGGGCTAATGATTCACCTTCTTCTTCTCAGTTA
TTTCCAAGGAAGCAAGGTGATGGAGACACACAGCCATTGTTGCAGGATCAACAACAACAGCAGCAGCAGCAGATAGTTCCATTGCAAGAC
AGCTACATGCAGAGTAGAGCCGAAGCTCTACAAAATGTCGAGTCTACTATCCATGAGCTGGGCAGCATTTTTAATCAGCTTGCTACTTTG
GTTTCTCAGCAAGGGGAGGTTGCAATCAGGATTGATGAGAACATGGACGACACACTAACAAATGTGGAAGGGGCACAAGGGGCTCTGCTC
AAGTACCTCAATAGCATCTCGTCAAATCGGTGGCTAATGATTAAGATATTCTTTGXTGTTGATTTTCTTCCTTATGATTTTCCTATTTTT
CGTGGCATAGTGAACAATGGTGACATTCGACAAAGTGTGATGTAG\
Edits in Original Sequence 
(5')GCACCGTCAGCTTCTGAATCXGTTTTTCGGATCAAATGGGCTCCTTCCTCCCCTCAACGTTCCTCATCTGATCTGCAAATCCTTCA
ATCCCCTACAGATcGAACAATTACTTAATCTCTCTACGCAAGATCTAGGGTTTTCATCATTCTCACCTTCGTCGGAGAAGATTTCTGGAT
CTCGCAGTTCTAGGGTTCTTCAGATCCAATCXGGTTTTTTGAATGCGGATGTGAAATTCTCTATGTTTATGATAATCGTGGAGCATAGAX
TCGACTTGATATCGGATCGATTTGTTAGTGTATTGAAAATTATAATTTGCGGAGATTATTATXTGAAAATGCCTGTGAAAGTAGCAAGTG
CGTCATTACGGGATCGGACTCAGGAGTTTCAGAGTATAGCGGAGAGGTTAAAGAAGTCATTTTCGTCGGTTCAGAATGGGTCGATTAGCA
CCAGCACCAGCAGTGGTTCTAGATCGGAGGAACAGAGGACCACTATTGCTATGCAATCGGAGTTCAATCGGCGAGCCTCCAAAATTGGTT
TTGGAATACATCAAACTTCTCAGAAGCTTGCAAAGCTAGCAAAGTTGGCAAAAAGGACTTCCGTTTTTGATGATCCGACTACGGAAATCC
AAGAGTTGACTGCAGTCATCAAGCAAGATATTACAGCACTTAACTCTGCTGTAGTAGATCTCCAGCTTCACTCTAATGCTCGTAATGAAA
GTGGTAATAGTGATACCACTAGTCACTCGACGACTGTTGTAGATGACTTGAAGAACAGGCTGATGACTGCCACAAAGGAGTTCAAAGAAG
TACTCACCATGCGGACAGAGAATATGAAGGTTCATGAGAACAGAAGACAGATGTTTTCTTCATCGACTAGCAAAGAAGCTTCAAATCCAT
TTATGCGCCAACGTCCACTAGCTTCAAGGAATACTGCTAGTACATCAGCCAGCCCTCCTCCTTGGGCTAATGATTCACCTTCTTCTTCTC
AGTTATTTCCAAGGAAGCAAGGTGATGGAGACACACAGCCATTGTTGCAGGATCAACAACAACAGCAGCAGCAGCAGATAGTTCCATTGC
AAGACAGCTACATGCAGAGTAGAGCCGAAGCTCTACAAAATGTCGAGTCTACTATCCATGAGCTGGGCAGCATTTTTAATCAGCTTGCTA
CTTTGGTTTCTCAGCAAGGGGAGGTTGCAATCAGGATTGATGAGAACATGGACGACACACTAACAAATGTGGAAGGGGCACAAGGGGCTC
TGCTCAAGTACCTCAATAGCATCTCGTCAAATCGGTGGCTAATGATTAAGATATTCTTTGXTGTTGATTTTCTTCCTTATGATTTTCCTA
TTTTTCGTGGCATAGTGAACAATGGTGACATTCGACAAAGTGTGATGTAG\(3')AAAGACAAATAATCGTGTATTTTAGATAAGCTGCT
CCGACCCCTGGTAACGCTACTGTAATGTTTCAAAAGTTCGAATTTGGTACCAACAACATTTTGAGGCATCTTTTTACCCTTGTCTTCCAT
CAGATGTCGCTTATTGTAGTTATTATACAACCCTGTAAGCTTGCTGGGACCCCACTAGTAAGTTGAAACTTGAAAGCTGTAACGTTTGGT
TACCAGAACAAGGGAAAAATTATCCTGGTATAAATACCTGTATTATTTTATACTCTGCTTGGTAATTATTTGAATTTTGTATAGTTAAAA
AAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan