ESTScan Details for Unigene SGN-U218244

Score 
714
Direction 
Forward
Predicted Peptide Sequence 
SQLQLKRPIHLSYMSTRANGCSPSTTGAPIFHFQSESVNIGAPVVLRLQPFALVDHIAKVDWSLLSQIPGERGGSFPVAVEELKYILNEL
NAHILPSTDNESILKTIAGGSVANTIRGLAAGFGISSGIIGACGEDEEGKLFMSNMGFYKVDLSRLRLKNGTTAQCVCLVDEVGNRTMRP
CLSGSVKVQADELKREDFKGSKWLVLRYAILNVEVIKVAIKIAKEEGLFVSLDLASFEMVRKFKSPLIELLESGNIDLCFANEDEATELL
RGEEKADPDAALEYLAKYCKWAVVTLAQNGCIAKHEKEFVRVPAIGEAKVTDATGAGDLFASGFLYGXGKRTVTGGMLSGGFLQRWFCDS
SLGGEVTPX
Predicted Coding Sequence 
XTTTCCCAGTTGCAGTTGAAGAGACCAATCCACCTTAGCTATATGTCTACTAGGGCAAATGGTTGTAGTCCAAGTACAACTGGTGCACCT
ATATTTCACTTTCAAAGTGAAAGTGTAAATATAGGTGCACCAGTTGTACTTCGACTACAACCATTTGCCCTAGTAGATCATATAGCTAAG
GTGGATTGGTCTCTTCTCTCCCAAATTCCCGGTGAACGTGGTGGCTCTTTCCCAGTTGCAGTTGAAGAGTTGAAGTATATACTCAACGAG
CTTAACGCCCATATCCTTCCTTCTACTGACAATGAATCCATATTGAAGACTATAGCTGGAGGTAGCGTTGCAAATACAATTAGAGGGTTG
GCTGCTGGTTTTGGGATTAGTAGTGGGATCATTGGGGCTTGTGGCGAAGATGAAGAAGGTAAATTATTTATGAGCAACATGGGCTTTTAC
AAAGTGGATCTCTCAAGATTGAGATTGAAGAATGGAACTACAGCTCAGTGTGTTTGTCTGGTTGACGAAGTTGGCAATCGTACCATGCGT
CCATGTTTGTCTGGCTCTGTGAAAGTTCAGGCAGATGAACTGAAAAGAGAGGACTTCAAAGGTTCTAAGTGGCTGGTACTGAGATATGCC
ATACTGAATGTAGAAGTTATTAAGGTGGCCATCAAAATAGCAAAGGAAGAAGGTCTTTTTGTTTCTCTAGATCTTGCCAGCTTTGAGATG
GTGAGGAAGTTTAAATCACCTCTAATTGAATTATTGGAGTCGGGAAACATAGACCTTTGCTTCGCAAACGAGGATGAAGCAACTGAGCTG
CTAAGGGGTGAAGAGAAAGCAGATCCTGATGCAGCACTTGAATATTTGGCTAAATATTGCAAGTGGGCTGTTGTCACCTTAGCTCAAAAC
GGATGCATTGCGAAACATGAGAAAGAGTTTGTGCGTGTTCCAGCAATTGGCGAAGCGAAAGTTACTGATGCTACAGGTGCAGGAGATCTG
TTTGCAAGTGGATTTTTGTATGGAXTTGGTAAGAGGACTGTCACTGGAGGAATGTTGTCGGGTGGGTTCTTGCAGCGGTGGTTCTGTGAT
TCATCTCTTGGGGGTGAGGTAACACCTGAX\
Edits in Original Sequence 
(5')XTTTCCCAGTTGCAGTTGAAGAGACCAATCCACCTTAGCTATATGaTCTACTAGGGCAAATGGTTGTAGTCCAAGTACAACTGGTG
CACCTATATTTaCACTTTCAAAGTGAAAGTGTAAATATAGGTGCACCAGTTGTACTTCGACTACAACCATTTGCCCTAGTAGATCATATA
GCTAAGGTGGATTGGTCTCTTCTCTCCCAAATTCCCGGTGAACGTGGTGGCTCTTTCCCAGTTGCAGTTGAAGAGTTGAAGTATATACTC
AACGAGCTTAACGCCCATATCCTTCCTTCTACTGACAATGAATCCATATTGAAGACTATAGCTGGAGGTAGCGTTGCAAATACAATTAGA
GGGTTGGCTGCTGGTTTTGGGATTAGTAGTGGGATCATTGGGGCTTGTGGCGAAGATGAAGAAGGTAAATTATTTATGAGCAACATGGGC
TTTTACAAAGTGGATCTCTCAAGATTGAGATTGAAGAATGGAACTACAGCTCAGTGTGTTTGTCTGGTTGACGAAGTTGGCAATCGTACC
ATGCGTCCATGTTTGTCTGGCTCTGTGAAAGTTCAGGCAGATGAACTGAAAAGAGAGGACTTCAAAGGTTCTAAGTGGCTGGTACTGAGA
TATGCCATACTGAATGTAGAAGTTATTAAGGTGGCCATCAAAATAGCAAAGGAAGAAGGTCTTTTTGTTTCTCTAGATCTTGCCAGCTTT
GAGATGGTGAGGAAGTTTAAATCACCTCTAATTGAATTATTGGAGTCGGGAAACATAGACCTTTGCTTCGCAAACGAGGATGAAGCAACT
GAGCTGCTAAGGGGTGAAGAGAAAGCAGATCCTGATGCAGCACTTGAATATTTGGCTAAATATTGCAAGTGGGCTGTTGTCACCTTAGCT
CAAAACGGATGCATTGCGAAACATGAGAAAGAGTTTGTGCGTGTTCCAGCAATTGGCGAAGCGAAAGTTACTGATGCTACAGGTGCAGGA
GATCTGTTTGCAAGTGGATTTTTGTATGGAXTTGGTAAGAGGACTGTCACTGGAGGAATGTTGTCGGGTGGGTTCTTGCAGCGGTGGTTC
TGTGATTCgATCTCTTGGGGGTGAGGTAACACCTGAX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan