Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U218266

Score 
828
Direction 
Forward
Predicted Peptide Sequence 
MATSGNKNMNAKLVLLGDVGAGKSSLVLRFVKGQFIEFQESTIGAAFFSQTVAVNDATVKFEIWDTAGQERYHSLAPMYYRGAAAAIIVY
DITNQASFDRAKKWVQELQAQGNPNMVMALAGNKADLLDARKVAAEEAQTYAEENGLFFMETSAKTASNVNDVFSEIAKRLPRLQPAQNP
SGMVLMDRPAQTPAVLLVALKSLLVLFISMLFLLNLFVLIIRVRCAHGPSLYRFHENIFNXAELFSVDPPNXNEICDMLKYAIKQYMHHI
TI
Predicted Coding Sequence 
ATGGCGACCAGTGGAAACAAGAATATGAACGCCAAATTGGTGCTCCTTGGGGATGTTGGAGCTGGAAAATCTAGTCTAGTTCTGCGTTTT
GTTAAAGGACAATTTATTGAATTTCAGGAATCAACCATAGGTGCTGCATTTTTCTCTCAAACAGTAGCAGTAAATGATGCAACTGTAAAA
TTTGAAATATGGGATACAGCAGGCCAAGAGAGATACCACAGTCTAGCTCCAATGTATTACAGAGGTGCTGCAGCTGCTATTATTGTTTAT
GATATAACAAATCAAGCATCATTTGATAGAGCAAAAAAATGGGTTCAGGAACTTCAAGCACAAGGTAATCCGAATATGGTGATGGCACTA
GCCGGAAATAAGGCAGATTTGTTAGATGCAAGAAAAGTGGCTGCTGAGGAAGCACAAACATATGCGGAGGAGAATGGTCTGTTCTTCATG
GAAACATCTGCAAAAACTGCATCTAATGTTAATGATGTTTTCTCTGAAATAGCAAAGAGACTGCCTCGACTTCAGCCAGCACAAAATCCA
TCTGGGATGGTTCTTATGGATAGGCCTGCTCAAACACCGGCAGTGCTTCTTGTTGCTCTTAAATCTCTGCTGGTGCTTTTCATCTCAATG
TTGTTTTTGCTTAATTTGTTTGTGCTGATTATTAGAGTTCGTTGTGCTCATGGTCCATCACTGTACAGATTTCATGAAAACATCTTCAAT
GXTGCTGAACTCTTTTCTGTGGATCCTCCTAATGXTAATGAGATTTGTGACATGCTCAAGTATGCTATTAAACAATACATGCATCATATA
ACTATT\
Edits in Original Sequence 
AGAAACAACTTTGGTTGAGTGTCCCTTTTTTTGCAATTTCTTGGCGTCAACCCTTCTTCTTCCTCTATCGTCTTTGTGAAGTCTAAATTC
TGATCAGAACCCTAATTGAAACAATCGCTAAATCTTCAAATAATCACTTTTCTCTTTCCCAATTTTGATCAATTACAGCT
(5')ATGGCG
ACCAGTGGAAACAAGAATATGAACGCCAAATTGGTGCTCCTTGGGGATGTTGGAGCTGGAAAATCTAGTCTAGTTCTGCGTTTTGTTAAA
GGACAATTTATTGAATTTCAGGAATCAACCATAGGTGCTGCATTTTTCTCTCAAACAGTAGCAGTAAATGATGCAACTGTAAAATTTGAA
ATATGGGATACAGCAGGCCAAGAGAGATACCACAGTCTAGCTCCAATGTATTACAGAGGTGCTGCAGCTGCTATTATTGTTTATGATATA
ACAAATCAAGCATCATTTGATAGAGCAAAAAAATGGGTTCAGGAACTTCAAGCACAAGGTAATCCGAATATGGTGATGGCACTAGCCGGA
AATAAGGCAGATTTGTTAGATGCAAGAAAAGTGGCTGCTGAGGAAGCACAAACATATGCGGAGGAGAATGGTCTGTTCTTCATGGAAACA
TCTGCAAAAACTGCATCTAATGTTAATGATGTTTTCTCTGAAATAGCAAAGAGACTGCCTCGACTTCAGCCAGCACAAAATCCATCTGGG
ATGGTTCTTATGGATAGGCCTGCTCAAACACCGGCtAGTGCTTCTTGTTGCTCTTAAATCTCTGCTGGTGCTTTTCATCTCAATGTTGTT
TTTGCTTAATTTGTTTGTGCTGATTATTAGAGTTCGTTGTGCTCATGGTCCATCACTGTACAGATTTCATGAAAACATCTTCAATGXTGC
TGAACTCTTTTCTGTGGATCCTCCTAATGXTAATGAGATTTGTGACATGCTCAAGTATGCTATTAAACAATACATGCATCATATAACTAT
T\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan