ESTScan Details for Unigene SGN-U218347

Score 
860
Direction 
Forward
Predicted Peptide Sequence 
VNLEKVHPSPPSTPLILAGSSFSKLRQPSILPHLQNPHKSSLLSTPLHFIPPTSDFFRSLIEXAAMSVKTVKVSNVSLGASERDIKEFFS
FSGDIEYVEMQSDTERSQIAYVTFNDSQGADTAVLLSGATIVDMSVTVTLDPVYQLPPTAFTASVPTGKKSAGNSESAFQKAEDVVSSML
AKGYILGKDAVGKAKSFDEKHQLTSTATAKVASLDKKIGLTEKISIGTSIVNDKVREVDQKLQVSDKAKSALSAAEQTVSSAGSAIMKNR
YVLTGSTWVAGAFSKVAKAAGEVGQMTKEKVGMTEDEQRQKMVTDFAQVHLSESPKASEFTEHQPAKPAPVQGLVL
Predicted Coding Sequence 
XGCGTCAATTTGGAAAAAGTTCACCCGTCACCACCGTCAACGCCGTTAATTCTCGCCGGCTCTTCATTCTCTAAACTCCGTCAACCCTCA
ATTCTTCCCCATCTCCAAAATCCTCATAAATCCTCTCTTCTCTCTACTCCTTTGCATTTCATTCCTCCAACATCTGATTTTTTCCGATCT
CTCATCGAAXCTGCTGCGATGTCGGTGAAAACTGTTAAAGTTAGCAATGTCTCCTTAGGGGCATCAGAGCGTGATATCAAGGAATTCTTT
TCTTTCTCTGGTGATATTGAATATGTTGAGATGCAAAGTGATACTGAACGAAGTCAAATAGCATATGTTACGTTCAATGATTCTCAGGGA
GCTGACACTGCAGTTCTTCTTTCGGGTGCAACAATAGTTGATATGTCTGTTACGGTGACTTTGGATCCAGTTTACCAGCTTCCTCCTACT
GCTTTTACAGCATCAGTGCCAACTGGAAAGAAAAGTGCTGGTAATTCAGAATCCGCTTTTCAGAAAGCAGAAGACGTTGTTAGCAGCATG
CTCGCAAAAGGTTATATCTTAGGTAAAGATGCTGTAGGGAAAGCAAAGTCTTTTGATGAGAAACACCAGTTGACCTCAACTGCAACTGCT
AAAGTGGCCTCTCTCGACAAAAAAATTGGTCTCACTGAAAAGATAAGCATTGGTACTTCCATTGTTAATGACAAAGTTCGAGAGGTGGAT
CAGAAACTCCAAGTTTCTGATAAAGCAAAATCAGCACTTTCTGCAGCTGAGCAAACAGTTAGTAGCGCTGGATCAGCCATTATGAAAAAT
CGGTATGTTCTGACTGGGTCCACTTGGGTAGCCGGCGCTTTTAGTAAGGTTGCTAAGGCAGCAGGGGAAGTAGGCCAGATGACAAAAGAG
AAAGTGGGAATGACAGAGGATGAGCAAAGGCAGAAAATGGTTACTGATTTCGCACAGGTTCATTTATCTGAGTCTCCGAAAGCTTCCGAG
TTCACAGAACATCAGCCAGCCAAGCCTGCACCAGTACAAGGTTTAGTCCTTTGA\
Edits in Original Sequence 
(5')XGCGTCAATTTGGAAAAAGTTCACCCGTCACCACCGTCAACGCCGTTAATTCTCGCCGGCTCTTCATTCTCTAAACTCCGTCAACC
CTCAATTCTTCCCCATCTCCAAAATCCTCATAAATCCTCTCTTCTCTCTACTCCTTTGCATTTCATTCtCTCCAACATCTGATTTTTTCC
GATCTCTCATCGAAXCTGCTGCGATGTCGGTGAAAACTGTTAAAGTTAGCAATGTCTCCTTAGGGGCATCAGAGCGTGATATCAAGGAAT
TCTTTTCTTTCTCTGGTGATATTGAATATGTTGAGATGCAAAGTGATACTGAACGAAGTCAAATAGCATATGTTACGTTCAATGATTCTC
AGGGAGCTGACACTGCAGTTCTTCTTTCGGGTGCAACAATAGTTGATATGTCTGTTACGGTGACTTTGGATCCAGTTTACCAGCTTCCTC
CTACTGCTTTTACAGCATCAGTGCCAACTGGAAAGAAAAGTGCTGGTAATTCAGAATCCGCTTTTCAGAAAGCAGAAGACGTTGTTAGCA
GCATGCTCGCAAAAGGTTATATCTTAGGTAAAGATGCTGTAGGGAAAGCAAAGTCTTTTGATGAGAAACACCAGTTGACCTCAACTGCAA
CTGCTAAAGTGGCCTCTCTCGACAAAAAAATTGGTCTCACTGAAAAGATAAGCATTGGTACTTCCATTGTTAATGACAAAGTTCGAGAGG
TGGATCAGAAACTCCAAGTTTCTGATAAAGCAAAATCAGCACTTTCTGCAGCTGAGCAAACAGTTAGTAGCGCTGGATCAGCCATTATGA
AAAATCGGTATGTTCTGACTGGGTCCACTTGGGTAGCCGGCGCTTTTAGTAAGGTTGCTAAGGCAGCAGGGGAAGTAGGCCAGATGACAA
AAGAGAAAGTGGGAATGACAGAGGATGAGCAAAGGCAGAAAATGGTTACTGATTTCGCACAGGTTCATTTATCTGAGTCTCCGAAAGCTT
CCGAGTTCACAGAACATCAGCCAGCCAAGCCTGCACCAGTACAAGGTTTAGTCCTTTGA\(3')GTTGAAGGCCCTTGTAAGAACTATCT
TTGAAGACTTCCACCTCGTACTACATTTCATTTTGCAATCCACTGTTTTATAAAGAAATGGCAAATGTAAAACAGTATGTCCAATACAAA
TATTTAGATGATTTATTTTGTATTTGTGCTTTTTACTGCTACAGANATTTGATTGAATTGAACATCAANTGGTATTTCCAAGTAGATAAA
AAAAAGAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan