ESTScan Details for Unigene SGN-U218469

Score 
770
Direction 
Reverse
Predicted Peptide Sequence 
MVRTPCHDEHGRKKGTWTPEEDRKLAAYITKYGSWNWRQLPKYAGLARCGKSCRLRWMNYLRPNVKRGNYTKEEDEIILNLHAQLGNKWS
TIASHLPGRSDNEIKNHWHTTVKKRADYNSSEGSKKCNNKKSESDITKRKSNVENQNAIGDNNNNNNTMHENVILENSEWSSSEDLSSID
YQQDIFQEELANLEDITSGSFWTQPFEVDTKIDFVAPSIDYCGLICPPSPFISHEFLSSFDLDHYDYNW
Predicted Coding Sequence 
ATGGTGAGAACACCTTGCCACGACGAACATGGTCGTAAAAAGGGTACTTGGACACCTGAAGAAGATAGAAAATTAGCAGCTTATATTACT
AAATATGGATCATGGAATTGGAGACAACTTCCCAAGTATGCTGGCTTAGCAAGGTGTGGAAAGAGTTGTAGACTTCGATGGATGAATTAT
TTAAGGCCAAATGTTAAAAGAGGAAACTACACAAAAGAAGAAGATGAAATCATCTTGAACCTCCATGCTCAACTTGGAAATAAGTGGTCA
ACGATTGCAAGTCACTTGCCAGGAAGATCAGATAACGAGATAAAGAATCATTGGCACACAACAGTGAAGAAGCGCGCTGATTATAACTCA
AGTGAAGGAAGCAAGAAATGCAATAATAAGAAGAGTGAAAGTGATATTACTAAAAGAAAGAGTAATGTGGAAAATCAAAATGCAATTGGT
GATAATAATAATAATAATAATACTATGCATGAAAATGTAATATTGGAAAATTCAGAATGGTCATCAAGTGAAGACTTATCCTCTATTGAT
TATCAACAAGACATTTTTCAAGAAGAATTAGCTAATTTGGAGGATATTACAAGTGGAAGTTTTTGGACACAACCATTTGAAGTGGATACT
AAAATTGATTTTGTAGCTCCTTCAATTGATTATTGTGGACTCATATGTCCACCTTCACCTTTTATATCTCATGAATTTCTTTCCTCCTTT
GATCTAGATCATTATGATTATAATTGGTAA\
Edits in Original Sequence 
ATGAACTTTAGCTATAGCTTCTTCACTTTGTAAATTTTAAAAAAAATAACTCTTTTTTTTTTGGAGTGAATTAATTTAGAG(5')ATGGT
GAGAACACCTTGCCACGACGAACATGGTCGTAAAAAGGGTACTTGGACACCTGAAGAAGATAGAAAATTAGCAGCTTATATTACTAAATA
TGGATCATGGAATTGGAGACAACTTCCCAAGTATGCTGGCTTAGCAAGGTGTGGAAAGAGTTGTAGACTTCGATGGATGAATTATTTAAG
GCCAAATGTTAAAAGAGGAAACTACACAAAAGAAGAAGATGAAATCATCTTGAACCTCCATGCTCAACTTGGAAATAAGTGGTCAACGAT
TGCAAGTCACTTGCCAGGAAGATCAGATAACGAGATAAAGAATCATTGGCACACAACAGTGAAGAAGCGCGCTGATTATAACTCAAGTGA
AGGAAGCAAGAAATGCAATAATAAGAAGAGTGAAAGTGATATTACTAAAAGAAAGAGTAATGTGGAAAATCAAAATGCAATTGGTGATAA
TAATAATAATAATAATACTATGCATGAAAATGTAATATTGGAAAATTCAGAATGGTCATCAAGTGAAGACTTATCCTCTATTGATTATCA
ACAAGACATTTTTCAAGAAGAATTAGCTAATTTGGAGGATATTACAAGTGGAAGTTTTTGGACACAACCATTTGAAGTGGATACTAAAAT
TGATTTTGTAGCTCCTTCAATTGATTATTGTGGACTCATATGTCCACCTTCACCTTTTATATCTCATGAATTTCTTTCCTCCTTTGATCT
AGATCATTATGATTATAATTGGTAA\(3')AAAGAAAAAATTAGAAGGGAAAAAGAACTCCCAATGAAGTTTGATTTATCTTATATCATC
ATATTCAATCTCTTACTTGGAGATGATTGATGACATAGAATGTAATGTGATTTAAGATGTTTAATATATTACATTCTGGGTAAAAAAAAA
AAAAAAAAAAAAACTCGA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan