ESTScan Details for Unigene SGN-U218506

Score 
281
Direction 
Forward
Predicted Peptide Sequence 
SSYISCTKTLPVPSDAATSSSDVEKLKKLILHNPYILTLPEVGETKDDIIPKNVQQFYISCAARDKLVHVLALLKLELVQKKVLIFTNSI
DTSFRLKLFFEQFGIKSAVLNAELPQSSRLHILEEFNAGLFDYLIATDESQSEGKEKVDDXKWQ
Predicted Coding Sequence 
AGCTCTTACATCTCATGTACCAAGACGTTGCCAGTGCCTTCTGATGCTGCAACCTCAAGTTCTGACGTTGAAAAGCTGAAGAAGCTTATT
TTACACAATCCCTACATCCTGACTTTGCCTGAGGTGGGAGAAACAAAGGATGACATTATCCCAAAAAATGTACAGCAATTTTATATTTCT
TGTGCTGCTCGTGATAAGCTTGTCCATGTCCTTGCCCTCTTGAAGCTTGAGTTGGTCCAGAAAAAAGTCTTGATATTTACAAATTCAATT
GACACGAGTTTTAGACTCAAACTATTCTTTGAGCAGTTTGGGATCAAGTCTGCAGTTTTAAATGCCGAGCTGCCTCAGAGTTCTCGTCTA
CACATCCTTGAGGAATTTAATGCTGGGCTATTTGATTACTTGATTGCGACTGATGAAAGTCAATCAGAAGGAAAGGAAAAAGTTGATGAT
XCAAAATGGCAGTGA\
Edits in Original Sequence 
(5')AGCTCTTACATCTCATGTACCAAGACGTTGCCAGTGCCTTCTGATGtCTGCAACCTCAAGTTCTGACGTTGAAAAGCTGAAGAAGC
TTATTTTACACAATCCCTACATCCTGACTTTGCCTGAGGTGGGAGAAACAAAGGATGACATTATCCCAAAAAATGTACAGCAATTTTATA
TTTCTTGTGCTGCTCGTGATAAGCTTGTCCATGTCCTTGCCCTCTTGAAGCTTGAGTTGGTCCAGAAAAAAGTCTTGATATTTACAAATT
CAATTGACACGAGTTTTAGACTCAAACTATTCTTTGAGCAGTTTGGGATCAAGTCTGCAGTTTTAAATGCCGAGCTGCCTCAGAGTTCTC
GTCTACACATCCTTGAGGAATTTAATGCTGGGCTATTTGATTACTTGATTGCGACTGATGAAAGTCAATCAGAAGGAAAGGAAAAAGTTG
ATGATXCAAAATGGCAGTGA\(3')GCGAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan