ESTScan Details for Unigene SGN-U218512

Score 
1078
Direction 
Forward
Predicted Peptide Sequence 
SKTSNGSYGDPSISPSFLYIDLIFVTRRIFTVPFNGVADLTAERRIDLTSHIVKVFLTLKVENIGESPASEVLLAFSPTEADRLAVVKAA
ASAGKKKKKSYVPLDVKPTDLPDGPNGTKYYLIHLLKPLGKGEAISLEVLYILTHSLEPFPVEISQSESQLVYYRDSAKILSPYPIKQQA
TFLKTPTSRVESFTRVVPTDRANTELRYGPYEEQPSFSYSPIIVHFENNKAFAVVEELVREIEISHWGSIQVTEHYKLVHAGARHKGAFS
RVEYQSRPNSGASSFKNLLAELPPRVHSVYYRDNIGNISSSRLRTNFKKSELLIEPRYPLFGGWKSTFVIGYGVPLEDFLFEAADGTRYL
NYSFGCPLAETVVDKLTVKVVLPEGSKNPSTVVPFPVEQRTERKYSYLDVVGRTVVVLEKSNVVPEHNSPFQVYYQFSPIYMLAEPLMLT
SVFFLFFMACVTYLHLDFSISKIKXNMSFDTIERTFDCEIXILVEAAATSSQPKVEDIV
Predicted Coding Sequence 
XCCTCAAAAACTAGCAATGGAAGCTATGGCGATCCTTCGATTAGCCCTAGTTTTCTCTATATTGACCTCATTTTCGTTACTCGCCGGATC
TTCACCGTCCCCTTCAACGGAGTTGCAGATCTCACCGCCGAACGCAGAATTGACTTGACATCACACATTGTGAAGGTGTTCTTGACATTG
AAGGTTGAAAATATTGGTGAATCTCCTGCTTCAGAAGTCCTTCTTGCCTTCTCTCCCACAGAAGCTGATCGTCTGGCAGTGGTAAAAGCA
GCCGCTTCTGCTGGAAAGAAGAAAAAGAAATCTTATGTGCCTCTAGATGTGAAGCCAACTGACCTGCCTGATGGACCAAATGGAACTAAG
TATTATTTAATACATTTGCTTAAGCCATTGGGTAAAGGTGAAGCCATCTCGCTAGAAGTTCTTTATATATTGACACATTCTCTTGAGCCT
TTCCCAGTAGAAATAAGCCAGTCGGAGTCTCAATTAGTTTATTACCGTGACAGTGCAAAAATCTTGTCACCTTATCCTATTAAACAACAA
GCTACGTTCCTAAAAACACCAACTAGCAGGGTCGAGTCGTTCACAAGAGTTGTGCCTACAGATCGTGCAAACACAGAACTAAGATATGGA
CCATATGAGGAGCAACCTTCATTTTCATATTCACCTATAATTGTCCATTTTGAAAACAATAAGGCGTTTGCTGTGGTTGAGGAGCTTGTG
CGCGAAATTGAAATCTCCCACTGGGGAAGCATACAGGTTACCGAACATTACAAATTGGTACATGCTGGTGCTCGGCATAAAGGTGCTTTC
TCGAGGGTTGAATATCAGTCTAGGCCAAACAGTGGTGCTTCCTCATTCAAGAATCTTCTTGCAGAATTGCCACCAAGGGTCCATTCTGTC
TACTACAGGGATAACATAGGGAACATTTCGTCCTCTCGCTTGCGCACAAATTTTAAGAAGTCAGAGCTGTTAATAGAACCACGGTATCCT
TTATTTGGAGGCTGGAAATCTACTTTTGTCATTGGATATGGGGTTCCACTAGAGGACTTCCTTTTTGAGGCAGCTGATGGCACACGTTAC
CTGAATTACAGTTTTGGATGTCCGCTTGCAGAAACTGTTGTTGACAAGTTGACTGTCAAAGTTGTGCTGCCAGAAGGATCAAAGAACCCA
TCCACTGTGGTTCCTTTTCCTGTGGAACAACGGACTGAGAGGAAATACTCATATCTTGATGTTGTGGGAAGGACAGTGGTGGTCCTGGAG
AAATCCAATGTAGTTCCTGAGCACAACTCCCCTTTCCAGGTCTATTACCAATTCAGCCCCATTTACATGCTTGCAGAGCCATTGATGTTG
ACTTCTGTCTTCTTCCTTTTCTTTATGGCTTGTGTGACTTATCTACATTTAGACTTTTCAATTAGCAAGATCAAGCAXAACATGAGTTTT
GACACTATTGAGAGAACTTTTGACTGTGAGATTAAXATATTAGTAGAAGCAGCTGCAACTTCCAGTCAACCAAAGGTAGAAGACATTGTA
TGA\
Edits in Original Sequence 
(5')XCCTCAAAAACTAGCAATGGAAGCTATGGCGATCCTTCGATTAGCCCTAGTTTTCTCTATATTGACCTCATTTTCGTTACTCGCCG
GATCTTCACCGTCCCCTTCAACGGAGTTGCAGATCgTCACCGCCGAACGCAGAATTGACTTGACATCACACATTGTGAAGGTGTTCTTGA
CATTGAAGGTTGAAAATATTGGTGAATCTCCTGCTTCAGAAGTCCTTCTTGCCTTCTCTCCCACAGAAGCTGATCGTCTGGCAGTGGTAA
AAGCAGCCGCTTCTGCTGGAAAGAAGAAAAAGAAATCTTATGTGCCTCTAGATGTGAAGCCAACTGACCTGCCTGATGGACCAAATGGAA
CTAAGTATTATTTAATACATTTGCTTAAGCCATTGGGTAAAGGTGAAGCCATCTCGCTAGAAGTTCTTTATATATTGACACATTCTCTTG
AGCCTTTCCCAGTAGAAATAAGCCAGTCGGAGTCTCAATTAGTTTATTACCGTGACAGTGCAAAAATCTTGTCACCTTATCCTATTAAAC
AACAAGCTACGTTCCTAAAAACACCAACTAGCAGGGTCGAGTCGTTCACAAGAGTTGTGCCTACAGATCGTGCAAACACAGAACTAAGAT
ATGGACCATATGAGGAGCAACCTTCATTTTCATATTCACCTATAATTGTCCATTTTGAAAACAATAAGGCGTTTGCTGTGGTTGAGGAGC
TTGTGCGCGAAATTGAAATCTCCCACTGGGGAAGCATACAGGTTACCGAACATTACAAATTGGTACATGCTGGTGCTCGGCATAAAGGTG
CTTTCTCGAGGGTTGAATATCAGTCTAGGCCAAACAGTGGTGCTTCCTCATTCAAGAATCTTCTTGCAGAATTGCCACCAAGGGTCCATT
CTGTCTACTACAGGGATAACATAGGGAACATTTCGTCCTCTCGCTTGCGCACAAATTTTAAGAAGTCAGAGCTGTTAATAGAACCACGGT
ATCCTTTATTTGGAGGCTGGAAATCTACTTTTGTCATTGGATATGGGGTTCCACTAGAGGACTTCCTTTTTGAGGCAGCTGATGGCACAC
GTTACCTGAATTACAGTTTTGGATGTCCGCTTGCAGAAACTGTTGTTGACAAGTTGACTGTCAAAGTTGTGCTGCCAGAAGGATCAAAGA
ACCCATCCACTGTGGTTCCTTTTCCTGTGGAACAACGGACTGAGAGGAAATACTCATATCTTGATGTTGTGGGAAGGACAGTGGTGGTCC
TGGAGAAATCCAATGTAGTTCCTGAGCACAACTCCCCTTTCCAGGTCTATTACCAATTCAGCCCCATTTACATGCTTGCAGAGCCATTGA
TGTTGACTTCTGTCTTCTTCCTTTTCTTTATGGCTTGTGTGACTTATCTACATTTAGACTTTTCAATTAGCAAGATCAAGCAXAACATGA
GTTTTGACACTATTGAGAGAACTTTTGACTGTGAGATTAAXATATTAGTAGAAGCAGCTGCAACTTCCAGTCAACCAAAGGTAGAAGACA
TTGTATGA\(3')ATTGTAATCAACTAAATTGGATTTTGAGAACATCTATTGTTGTTTACCTTTAGATCATGTCTTCTTACAACTACTGT
ATTGGTCTTGCATCTGAGAGATGGTATGCAGAGAACTGCTTACAGGTTCGTCTTTTCGTCTAAAAAAAAAAAAAAAAAACTCGAGA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan