ESTScan Details for Unigene SGN-U218533

Score 
556
Direction 
Forward
Predicted Peptide Sequence 
GANDVSMIQAAHVGVGISGQEGMQAVMSSDFAIAQFRFLTDLLLVHGRWSYLRICKVVTYFFYKNLMFTLTQFWFTFRTGFSGQRFYDDW
FQSLYNVIFTALPVIILGLFEKDVSASLSKKYPELYKEGIRNTFFKWRVVATWAFFAVYQSLILYNFVIHSSTKGMNSSGKMFGLWDVST
MAYTCVVVTVNLRLLMMCNTITRWHHISVGGSILLWFIFVFIYSGIHLHKEQEGIYLVIIVLISTLYFYLALLLVPVAALFVXLPISGGT
KMVFPIDYQIVQEIHKHEIDNSRIGLLEIRNELSPDEERRYAIMQLPGQRSKHTGFAFDSPGYESFFASQAGXVGTSEGVGRCSESKHDE
ITTKGT
Predicted Coding Sequence 
XXTGGTGCTAATGACGTGAGTATGATTCAAGCTGCTCATGTTGGTGTTGGAATAAGTGGACAGGAGGGAATGCAAGCAGTGATGTCTAGT
GATTTTGCAATAGCTCAGTTCCGCTTTCTCACTGATTTATTGCTTGTCCATGGACGCTGGTCATATCTTAGAATATGCAAGGTGGTGACA
TATTTCTTTTACAAGAATCTGATGTTTACACTCACTCAGTTTTGGTTTACCTTCCGCACTGGATTCTCTGGTCAAAGGTTCTATGATGAT
TGGTTCCAGTCTCTCTACAATGTGATCTTCACAGCGCTTCCTGTTATTATTCTTGGGCTTTTTGAGAAGGATGTCAGTGCATCTCTCTCG
AAGAAATATCCTGAGTTATACAAAGAAGGAATTAGAAATACATTCTTCAAATGGAGAGTTGTGGCTACCTGGGCTTTTTTTGCAGTATAT
CAATCATTAATCTTGTATAATTTTGTAATCCATTCGAGTACGAAGGGCATGAATTCATCTGGCAAGATGTTTGGCCTATGGGATGTCAGT
ACAATGGCCTACACCTGTGTTGTTGTAACTGTCAATTTACGTCTCCTTATGATGTGCAACACAATTACAAGATGGCATCACATTAGCGTT
GGAGGGAGCATATTATTATGGTTCATTTTTGTATTTATCTACTCGGGTATCCACTTGCACAAAGAACAGGAGGGTATCTATTTAGTCATC
ATTGTTCTGATAAGCACATTATACTTCTACCTTGCGCTGCTTCTCGTACCAGTTGCTGCACTTTTTGTTGAXCTTCCTATATCAGGGGGT
ACAAAGATGGTTTTCCCCATTGATTACCAGATTGTTCAGGAAATTCACAAGCACGAAATCGACAACAGCAGGATTGGTTTATTAGAGATC
CGTAACGAGCTTTCTCCAGATGAAGAAAGGAGATACGCCATAATGCAACTTCCTGGACAGAGATCAAAACATACTGGTTTTGCTTTTGAT
TCACCCGGTTATGAGTCATTTTTCGCATCTCAGGCTGGCXGTGTTGGCACCTCAGAAGGCGTGGGACGTTGCTCGGAGAGCAAGCATGAT
GAAATCACGACCAAAGGTACCTAA\
Edits in Original Sequence 
(5')XXTGGTGCTAATGACGTGAGTATGATTCAAGCTGCTCATGTTGGTGTTGGAATAAGTGGACAGGAGGGAATGCAAGCAGTGATGTC
TAGTGATTTTGCAATAGCTCAGTTCCGCTTTCTCACTGATTTATTGCTTGTCCATGGACGCTGGTCATATCTTAGAATATGCAAGGTGGT
GACATATTTCTTTTACAAGAATCTGATGTTTACACTCACTCAGTTTTGGTTTACCTTCCGCACTGGATTCTCTGGTCAAAGGTTCTATGA
TGATTGGTTCCAGTCTCTCTACAATGTGATCTTCACAGCGCTTCCTGTTATTATTCTTGGGCTTTTTGAGAAGGATGTCAGTGCATCTCT
CTCGAAGAAATATCCTGAGTTATACAAAGAAGGAATTAGAAATACATTCTTCAAATGGAGAGTTGTGGCTACCTGGGCTTTTTTTGCAGT
ATATCAATCATTAATCTTGTATAATTTTGTAATCCATTCGAGTACGAAGGGCATGAATTCATCTGGCAAGATGTTTGGCCTATGGGATGT
CAGTACAATGGCCTACACCTGTGTTGTTGTAACTGTCAATTTACGTCTCCTTATGATGTGCAACACAATTACAAGATGGCATCACATTAG
CGTTGGAGGGAGCATATTATTATGGTTCATTTTTGTATTTATCTACTCGGGTATCCACTTGCACAAAGAACAGGAGGGTATCTATTTAGT
CATCATTGTTCTGATAAGCACATTATACTTCTACCTTGCGCTGCTTCTCGTACCAGTTGCTGCACTTTTTGTTGAXCTTCCTATATCAGG
GGGTACAAAGATGGTTTTCCCCATaTGATTACCAGATTGTTCAGGAAATTCACAAGCACGAAATCGACAACAGCAGGATTGGTTTATTAG
AGATCCGTAACGAGCTTTCTCCAGATGAAGAAAGGAGATACGCCATAATGCAACTTCCTGGACAGAGATCAAAACATACTGGTTTTGCTT
TTGATTCACCCGGTTATGAGTCATTTTTCGCATCTCAGGCTGGCXGTGTTGGCACCTCAGAAGGCGTGGGACGTTGCTCGGAGAGCAAGC
ATGATGAAATCACGACCAAAGGTACCTAA\(3')AAAGAGCTGAGTTCCCTAAAATTTTGTACAAATTTTCTTCTTTAACCTTTCTTCTC
TCCTATACAGCTTTTAACAGCTACGTAGAATTATTTCACTCTCATTCTTCGTACCGTTTCGAGTTAATTCTACAGTTACATACATATATA
TATATATAGTCTCTAGTTGTGTTTAGTGAGATTGTAGTAAAAATAACTGAGAAGAAAACAATAATGTACATTATTTAATGTAACCATCCC
ATACACACTTGCCAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan