ESTScan Details for Unigene SGN-U218543

Score 
1012
Direction 
Forward
Predicted Peptide Sequence 
QSARPGYSSNMRGIPVQSIHQKPAGIKQASKVVQIPVHFVSSDPERSVLASATKKPEPDRSGSAVEDPEGIQRLFGEKKREENQVDTKEV
EDVERKLLCRETAELICRDERERLRVNETLMSLLFKLDSIRGVDSGVRECRKAVIRKAIYLQEKVDCIVAAANQIAAEEENQSDELSEPV
NQTGDIPNSTGKQDEDGKLTNQNELCHLSEQSVDVETQAASNDEKTPIEGEHDVAPLNEKRGGLQEVKQETDCPMLECVEESVERGEVGD
LIEVVEDVNENENENETRSHKFEGGEKSKRNRELLEKMVEKNENMMRMMTELCHKNELQTRXAEFAGPESGSIKENFFM
Predicted Coding Sequence 
XCCCAGTCAGCTCGCCCTGGCTATTCCTCAAACATGAGAGGAATTCCAGTGCAATCGATTCACCAGAAACCTGCCGGAATCAAGCAGGCC
TCCAAGGTTGTTCAGATTCCGGTCCATTTCGTTAGTTCGGATCCCGAGCGGTCCGTTTTGGCCTCGGCGACAAAGAAACCTGAGCCGGAT
AGGTCCGGTTCAGCXGTTGAAGATCCAGAAGGTATTCAGAGGCTTTTTGGTGAGAAAAAGCGTGAAGAAAATCAAGTTGATACAAAAGAG
GTGGAAGATGTTGAGCGGAAGCTTTTGTGTAGAGAAACGGCGGAGTTGATTTGTAGAGATGAAAGGGAAAGGTTGCGGGTGAATGAGACG
CTGATGTCTCTGCTTTTCAAGTTGGACTCCATTCGTGGAGTTGATTCCGGTGTTAGGGAGTGCAGAAAGGCTGTGATTAGAAAGGCCATC
TATTTGCAAGAGAAAGTCGACTGCATTGTTGCTGCTGCAAATCAAATTGCAGCTGAAGAGGAGAATCAATCCGATGAACTCTCTGAACCA
GTCAATCAGACCGGAGACATCCCCAATTCAACAGGAAAACAGGATGAAGATGGAAAATTGACAAATCAGAATGAACTTTGTCATCTGTCA
GAGCAGAGTGTGGATGTAGAAACTCAAGCAGCATCAAATGATGAGAAAACACCCATAGAGGGTGAACACGATGTAGCACCGCTGAATGAG
AAGCGTGGAGGATTGCAGGAGGTGAAGCAGGAAACGGACTGTCCAATGCTCGAATGTGTGGAGGAAAGTGTGGAGAGAGGTGAAGTTGGG
GATTTGATCGAAGTAGTTGAGGATGTGAATGAGAATGAGAATGAGAATGAAACAAGGTCACACAAGTTTGAAGGGGGAGAAAAGAGTAAA
AGAAACCGAGAGTTGTTGGAGAAAATGGTGGAAAAGAATGAGAATATGATGAGAATGATGACTGAACTGTGCCACAAAAATGAACTACAA
ACACGAXATGCTGAATTCGCTGGCCCAGAGAGTGGATCAATTAAAGAAAACTTTTTTATGTGA\
Edits in Original Sequence 
(5')XCCCAGTCAGCTCGCCCTGGCTATTCCTCAAACATGAGAGGAATTCCAGTGCAATCGATTCACCAGAAACCTGCCGGAATCAAGCA
GGCCTCCAAGGTTGTTCAGATTCCGGTCCATTTCGTTAGTTCGGATCCCGAGCGGTCCGTTTTGGCCTCGGCGACAAAGAAACCTGAGCC
GGATAGGTCCGGTTCAGCXGTTGAAGATCCAGAAGGTATTCAGAGGCTTTTTGGTGAGAAAAAGCGTGAAGAAAATCAAGTTGATACgAA
AAGAGGTGGAAGATGTTGAGCGGAAGCTTTTGTGTAGAGAAACGGCGGAGTTGATTTGTAGAGATGAAAGGGAAAGGTTGCGGGTGAATG
AGACGCTGATGTCTCTGCTTTTCAAGTTGGACTCCATTCGTGGAGTTGATTCCGGTGTTAGGGAGTGCAGAAAGGCTGTGATTAGAAAGG
CCATCTATTTGCAAGAGAAAGTCGACTGCATTGTTGCTGCTGCAAATCAAATTGCAGCTGAAGAGGAGAATCAATCCGATGAACTCTCTG
AACCAGTCAATCAGACCGGAGACATCCCCAATTCAACAGGAAAACAGGATGAAGATGGAAAATTGACAAATCAGAATGAACTTTGTCATC
TGTCAGAGCAGAGTGTGGATGTAGAAACTCAAGCAGCATCAAATGATGAGAAAACACCCATAGAGGGTGAACACGATGTAGCACCGCTGA
ATGAGAAGCGTGGAGGATTGCAGGAGGTGAAGCAGGAAACGGACTGTCCAATGCTCGAATGTGTGGAGGAAAGTGTGGAGAGAGGTGAAG
TTGGGGATTTGATCGAAGTAGTTGAGGATGTGAATGAGAATGAGAATGAGAATGAAACAAGGTCACACAAGTTTGAAGGGGGAGAAAAGA
GTAAAAGAAACCGAGAGTTGTTGGAGAAAATGGTGGAAAAGAATGAGAATATGATGAGAATGATGACTGAACTGTGCCACAAAAATGAAC
TACAAACACGAXATGCTGAATTCGCTGGCCCAGAGAGTGGATCAATTAAAGAAAACTTTTTTATGTGA\(3')TAGGTTGAAGACAAAGA
AGAAGAAAAGGCACACTGCTTGATTCTTTCTGTAGCAAAAATGTCATAGTAGATTTTTTTTTTGGTGTTTCTGGGCCTGTTTCTTGTGGC
TTTTATATTTCACCCTGTGATATTGGAATGTACTGATTGGTAAACAAAGATTTTGGAAAGTGAATTATAAAGAAATTTCCATATATTGTT
AAAAAAAAAAAAAAAAAAACTTTTTTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan