ESTScan Details for Unigene SGN-U218635

Score 
492
Direction 
Forward
Predicted Peptide Sequence 
MRGVGGPLLCIGDLLSDVGESDAGGDQLPSHPINTPPPDFNSSLQPSDLNKLFQEKYEQLNKALAGTDHSWTHLTLELCTALETANKLVH
STNSNVGMLKDKVEELWEVINRRDATIEGQKPLKALQNNLRAVSEDXLINYQVEGQQSCFALDLSLLAFTRTFLPVLAVNMHEXKDIGTG
NT
Predicted Coding Sequence 
ATGAGAGGAGTGGGAGGGCCGTTGTTATGCATCGGCGATCTGCTGAGTGACGTTGGAGAAAGCGATGCCGGCGGTGATCAACTTCCGTCG
CACCCAATCAATACACCTCCACCGGATTTCAACTCCAGCCTCCAACCCTCCGATCTAAACAAGCTCTTTCAGGAAAAGTATGAGCAGCTG
AACAAGGCACTTGCTGGCACAGATCATTCATGGACGCATCTCACACTGGAGCTATGCACTGCACTGGAGACTGCAAACAAGTTGGTTCAC
TCGACCAATTCTAATGTTGGCATGTTGAAAGATAAGGTTGAGGAGCTTTGGGAAGTCATTAATAGAAGAGACGCAACTATTGAAGGGCAA
AAGCCTTTGAAGGCTCTCCAAAACAACCTGAGAGCAGTTAGTGAGGATGXTCTGATCAATTACCAAGTTGAAGGTCAGCAGTCTTGCTTT
GCACTGGACTTATCACTTCTAGCTTTTACAAGGACATTTTTGCCTGTTCTTGCTGTAAATATGCATGAAXTTAAAGATATTGGTACTGGC
AATACTTAA\
Edits in Original Sequence 
GTCAATAATATTTTTCCAATTTAACTCAATTTATGGTTTAGTCCAATTTTCGAGTTGATTTTGTACAACGCTTAACCAACGAGAGAG(5')
ATGAGAGGAGTGGGAGGGCCGTTGTTATGCATCGGCGATCTGCTGAGTGACGTTGGAGAAAGCGATGCCGGCGGTGATCAACTTCCGTC
GCACCCAATCAATACACCTCCACCGGATTTCAACTCCAGCCTCCAACCCTCCGATCTAAACAAGCTCTTTCAGGAAAAGTATGAGCAGCT
GAACAAGGCACTTGCTGGCACAGATCATTCATGGACGCATCTCACACTGGAGCTATGCACTGCACTGGAGACTGCAAACAAGTTGGTTCA
CTCGACCAATTCTAATGTTGGCATGTTGAAAGATAAGGTTGAGGAGCTTTGGGAAGTCATTAATAGAAGAGACGCAACTATTGAAGcGGC
AAAAGCCTTTGAAGGCTCTCCAAAACAACCTGAGAGCAGTTAGTGAGGATGXTCTGATCAATTACCAAGTTGAAGGTCAGCAGTCTTGCT
TTGCACTGGACTTATCACTTCTAGCTTTTACAAGGACATTTTTaGCCTGTTCTTGCTGTAAATATGCATGAAXTTAAAGATATTGGTACT
GGCAATACTTAA\(3')GCTGCATTTGCTGCACCTGCTTCCCATTCGTCCCTTGCCAAAGCTTACATTTTATTTTGTTACTTATGAAGTC
ATTTCACTATGTACGCCTTGGTACTTCTGTAATCCTTGTTCTGACTATGTGTAGTGTAGGTTTGTCTTATGCTGAAGCAGTGATAGATCT
CATAGAATCCCGTTATGATAGAAAGGATATTCTTCTGGCACTTTTTAAGTATTTTTAACAGCACCTTCTTGGCGCTACATTAATAATACA
CTAACCATTTCTCAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan