ESTScan Details for Unigene SGN-U218644

Score 
542
Direction 
Forward
Predicted Peptide Sequence 
KNLLEXEKDERRKERAAEASNKVAWKPNAGIKINETEVGGKFRPLSEITGVCLRCRDQIDWKRKYGKYKAITEPAKXSEVFEKKRAQAYH
NLCNGCAKEHKVCAKCSCRVGQVVGRDVSEVEAEKKALEEAIKNARERDRRSLLRAMNKGKSQSSEKNLSQDDMKVGELNTASSLEEYAK
VNRDDDEDGELNTASSLEEYAKVNRDDDEDDDDEEDEGQVI
Predicted Coding Sequence 
AAAAATCTTTTAGAAGAXGAAAAAGATGAGCGGCGTAAGGAAAGGGCCGCCGAAGCATCAAACAAAGTCGCCTGGAAACCTAACGCCGGT
ATCAAAATCAATGAAACGGAAGTGGGTGGAAAATTTAGGCCTCTCTCAGAAATAACAGGAGTATGTCTTCGTTGTAGAGATCAAATTGAT
TGGAAGCGCAAGTATGGAAAATACAAAGCCATTACTGAACCTGCTAAGXTGTCAGAAGTGTTCGAAAAGAAACGTGCTCAAGCTTACCAC
AATCTCTGCAATGGCTGTGCAAAGGAGCATAAAGTATGTGCCAAGTGTTCATGTCGTGTTGGTCAAGTGGTTGGAAGAGATGTTTCAGAA
GTAGAGGCTGAGAAAAAAGCTCTTGAGGAGGCTATCAAGAATGCTCGAGAACGGGATAGGCGGTCACTTCTACGAGCTATGAACAAAGGG
AAGTCACAGAGTTCAGAGAAAAACCTAAGTCAAGATGACATGAAAGTTGGTGAACTGAATACAGCATCATCACTTGAGGAATATGCTAAG
GTAAACCGTGATGATGACGAAGATGGTGAACTGAATACAGCATCATCACTTGAGGAATATGCCAAGGTAAACCGCGATGATGACGAAGAT
GATGATGATGAAGAAGATGAAGGTCAAGTTATTTGA\
Edits in Original Sequence 
(5')AAAAATCTTTTAGAAGAXGAAAAAGATGAGCGGCGTAAGGAAAGGGCCGCCGAAGCATCAgAACAAAGTCGCCTGGAAACCTAACG
CCGGTATCAAAATCAATGAAACGGAAGTGGGTGGAAAATTTAGGCCTCTCTCAGAAATAACAGGAGTATGTCTTCGTTGTAGAGATCAAA
TTGATTGGAAGCGCAAGTATGGAAAATACAAAGCCATTACTGAACCTGCTAAGXTGTCAGAAGTGTTCGAAAAGAAACGTGCgTCAAGCT
TACCACAATCTCTGCAATGGCTGTGCAAAGGAGCATAAAGTATGTGCCAAGTGTTCATGTCGTGTTGGTCAAGTGGTTGGAAGAGATGTT
TCAGAAGTAGAGGCTGAGAAAAAAGCTCTTGAGGAGGCTATCAAGAATGCTCGAGAACGGGATAGGCGGTCACTTCTACGAGCTATGAAC
AAAGGGAAGTCACAGAGTTCAGAGAAAAACCTAAGTCAAGATGACATGAAAGTTGGTGAACTGAATACAGCATCATCACTTGAGGAATAT
GCTAAGGTAAACCGTGATGATGACGAAGATGGTGAACTGAATACAGCATCATCACTTGAGGAATATGCCAAGGTAAACCGCGATGATGAC
GAAGATGATGATGATGAAGAAGATGAAGGTCAAGTTATTTGA\(3')GATGCACAATTTGGAGAATAACCATATGGCCCTTTATAGATCT
CCCTTCATGGTCCATAGTTTGATGCACACTAGCTCATTTGTATTGGCAGCTTTGGAGAAAAGTAATTTATTGGGCAAAATTGATACAGGC
TGTTTGGTTTGCCTCCCCTTCTACAGTAAAGGACTAAGAGTGAGATCAACACACTATTCCATTCCTTTTCCATTTCATATTTTCCTAGCT
AGTGAAGAGTTCTGAGAGTGTAATATAGAGTAAGATAGATTCTTAAGCCATTTTTTAATGTAATTCAGCTAAAAAGACAGCCTGCTAGTT
GCTTCATAATGTGATGTAGGAGCATTGATGTTTTGTTGGTCAATTTACTCAAATAGTAACTGGTCTTTGGTTTTTTGGAACTTTATGGCC
CATCAAATTATCTCAAGAATAAATTGGCTGGCTGGGCGTTTGCAACTCCAAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan