ESTScan Details for Unigene SGN-U218660

Score 
618
Direction 
Forward
Predicted Peptide Sequence 
MAGSGNSGINPELVISHKFPESLHTYTERDAAIYALGVGACTKDAIDDKELKYVYHQDGQEFIQVLPTFSTLFTVGIPSQMERLPGLQFD
PRLLLHGQQYIEVYKPLPSHGCILNKRSIVGLHDKGKAAVLEVEIVSYEKESGERLCMNRLSIYLRGAGGFSKSSQPYSYSTNRNNQSAF
PKIPKSQPFAVYEECTHASQALLYRLSGDYNPLHSDPKFAEGAGFSRPILHGLCTLGFAVRTIIKCICGGDQNTDKERIWQISTTCLSRR
NFNHRNVVGRVESYLSSEG
Predicted Coding Sequence 
ATGGCAGGGTCTGGAAATTCTGGAATTAATCCTGAATTAGTCATTTCCCACAAATTCCCTGAGAGCTTACATACTTACACTGAAAGGGAT
GCTGCTATTTATGCTCTTGGTGTAGGAGCATGTACAAAGGATGCTATTGATGATAAAGAACTTAAATATGTTTATCATCAAGATGGGCAA
GAATTTATTCAGGTTTTGCCAACTTTTTCGACTTTGTTCACTGTTGGAATTCCTTCTCAAATGGAGCGGCTTCCAGGCTTGCAATTTGAT
CCACGTCTTCTACTGCACGGCCAACAATACATTGAAGTCTATAAGCCACTTCCTTCCCATGGCTGCATACTAAATAAAAGGAGTATTGTC
GGATTGCATGATAAAGGTAAAGCAGCTGTTCTTGAAGTAGAAATTGTGAGTTACGAGAAAGAATCTGGTGAACGGCTATGCATGAACCGC
TTGTCTATTTACTTGAGGGGTGCTGGTGGGTTCTCAAAGTCATCTCAGCCTTACTCGTACTCAACCAACCGTAATAATCAGTCTGCCTTT
CCTAAAATTCCCAAAAGCCAACCCTTTGCTGTATATGAAGAATGTACACATGCATCACAGGCTTTGCTATATCGGCTATCTGGTGATTAC
AATCCATTGCATTCAGATCCAAAGTTCGCAGAAGGTGCAGGGTTTTCTCGTCCAATACTGCATGGGTTGTGCACACTTGGATTTGCAGTT
AGGACTATTATTAAGTGTATTTGTGGAGGTGATCAGAACACXGATAAAGAGCGTATCTGGCAGATTTCTACTACATGTCTATCCAGGAGA
AACTTTAATCACAGAAATGTGGTTGGAAGGGTTGAGAGTTATCTATCAAGTGAAGGTTAA\
Edits in Original Sequence 
CATTATCTATCAACCTCGATCCTAGTTCCAAATCCATAACCAATTTGTTGTTGTGCTAAAAAAAAAAAAATTGTTGAAAATTGGGGATTT
TTTTTTTCTCATAAGATTTA
(5')ATGGCAGGGTCTGGAAATTCTGGAATTAATCCTGAATTAGTCATTTCCCACAAATTCCCTGAGAGC
TTACATACTTACACTGAAAGGGATGCTGCTATTTATGCTCTTGGTGTAGGAGCATGTACAAAGGATGCTATTGATGATAAAGAACTTAAA
TATGTTTATCATCAAGATGGGCAAGAATTTATTCAGGTTTTGCCAACTTTTTCGACTTTGTTCACTGTTGGAATTCCTTCTCAAATGGAG
CGGCTTCCAGGCTTGCAATTTGATCCACGTCTTCTACTGCACGGCCAACAATACATTGAAGTCTATAAGCCACTTCCTTCCCATGGCTGC
ATACTAAATAAAAGGAGTATTGTCGGATTGCATGATAAAGGTAAAGCAGCTGTTCTTGAAGTAGAAATTGTGAGTTACGAGAAAGAATCT
GGTGAACGGCTATGCATGAACCGCTTGTCTATTTACTTGAGGGGTGCTGGTGGGTTCTCAAAGTCATCTCAGCCTTACTCGTACTCAACC
AACCGTAATAATCAGTCTGCCTTTCCTAAAATTCCCAAAAGCCAACCCTTTGCTGTATATGAAGAATGTACACATGCATCACAGGCTTTG
CTATATCGGCTATCTGGTGATTACAATCCATTGCATTCAGATCCAAAGTTCGCAGAAGGTGCAGGGTTTTCTCGTCCAATACTGCATGGG
TTGTGCACACTTGGATTTGCAGTTAGGACTATTATTAAGTGTATTTGTGGAGGTGATCAGAACACXGATAAAGAGCGTATCTGGCAGATT
TCTACTACATGTCTATCCAGGAGAAACTTTAATCACAGAAATGTGGTTGGAAGGGTTGAGAGTTATCTATCAAGTGAAGGTTAA\(3')G
GAACGTAACCGTGCAGTTCTTTTTGGATTCGTGGATCTTAATCATTTAAGTTCATCTCTGTGAGTGTTTGTGGCGCGCTCATAAACGAAA
TAATGCTTTGTATAATACTCTTTTAATTCATACTTTAAGGTAATTTATAGACTCTGGATCATATTAAGTTTCATTTATGAGTTCTCATGG
TACATTACTAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan