ESTScan Details for Unigene SGN-U218663

Score 
266
Direction 
Forward
Predicted Peptide Sequence 
TTNTCGFNIEGLKRSSHALAVRQGLLREEXKKGSEGLKSIGRSLGFGVSRAVFPEDLKVSEKKIFDPQDKFLLLWNKLFVVSCILAVSVD
PLFFYLPVFDNKSNCLQIDRKLAVIATTLRTVIDAFYLIHMALQFRTAYIAPSSRVFGRGELVIDPAQIAKRYLRFYFIIDFLAXASLAA
DCGLEIPEELPGSDVFTTKQALLYIX
Predicted Coding Sequence 
XTAACAACAAATACATGTGGCTTCAATATTGAGGGTTTAAAACGTTCAAGCCATGCACTAGCAGTCCGTCAAGGTCTTTTAAGAGAGGAG
XTGAAAAAAGGATCCGAAGGACTTAAATCAATTGGTCGATCACTGGGATTTGGTGTCTCTCGGGCTGTATTTCCGGAAGATCTGAAAGTT
TCAGAGAAGAAGATTTTTGACCCTCAAGATAAATTCCTTCTGTTATGGAACAAACTGTTTGTTGTATCATGTATTCTAGCCGTGTCTGTG
GACCCACTGTTTTTCTACCTTCCAGTTTTTGATAACAAGTCAAATTGCCTTCAGATCGATAGGAAGCTAGCTGTCATAGCCACTACCCTA
CGTACAGTGATTGATGCTTTCTATCTTATTCACATGGCTCTTCAGTTCCGCACAGCTTATATTGCACCGTCATCTCGAGTTTTTGGACGG
GGTGAACTTGTGATAGATCCTGCACAGATTGCTAAAAGATACTTGCGATTCTATTTTATCATCGATTTTCTTGCTGXTGCTTCCCTTGCC
GCAGATTGTGGTCTGGAGATTCCTGAAGAGCTNCCAGGTTCTGATGTCTTCACTACAAAGCAAGCTTTGCTTTACATCATX\
Edits in Original Sequence 
(5')XTAACAACAAATACATGTGGCTTCAATATTGAGGGTTTAAAACGTTCAAGCCATGCgACTAGCAGTCCGTCAAGGTCTTTTAAGAG
AGGAGXTGAAAAAAGGATCCGAAGGACTTAAATCAATTGGTCGATCACTGGGATTTGGTGTCTCTCGGGCTGTATTTCCGGAAGATCTGA
AAGTTTCAGAGAAGAAGATTTTTGACCCTCAAGATAAATTCCTTCTGTTATGGAACAAACTGTTTGTTGTATCATGTATTCTAGCCGTGT
CTGTGGACCCACTGTTTTTCTACCTTCCAGTTTTTGATAACAAGTCAAATTGCCTTCAGATCGATAGGAAGCTAGCTGTCATAGCCACTA
CCCTACGTACAGTGATTGATGCTTTCTATCTTATTCACATGGCTCTTCAGTTCCGCACAGCTTATATTGCACCGTCATCTCGAGTTTTTG
GACGGGGTGAACTTGTGATAGATCCTGCACAGATTGCTAAAAGATACTTGCGATTCTATTTTATCATCGATTTTCTTGCTGXTGCTTCCC
TTGCCGCAGATTGTGGTCTGGAGATTCCTGAAGAGCTNCaCAGGTTCTGATGTCTTCACTACAAAGCAAGCTTTGCTTTACATCATX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan