ESTScan Details for Unigene SGN-U218672

Score 
853
Direction 
Forward
Predicted Peptide Sequence 
ILKAPLTHHYPLFQPFLSFNFFSPVLHTQNLEINSNTEGMVSFASTLPSLVSFIPSPSSITNASRNPPQPGMICCKFRSELNNEDRFHRR
DILQSVGAAVGMDLIARSSAFIEVANAADLIQRRQRSDFQSKIKLTLYDAIKANPDIIPSLLTLALNDAITYDKATKTGGPMDPYVSAQR
SAXPENKGLDAALNLLEESKKVIDLDSKGGPISYADLIQFAAQSAVKSTFIASAISKCGGNVEKGTLLYSAYGSNGQWGQFDRIFGRSDA
QEPDPEGRVPQWDKASVQEMKDKFKAVGLGPRQLAVMSSFLGPDQAATEALLASDPEVLPWIQKYQRSRETVSRTDYEVDLITTVTKLSS
LGQVINYEAYTYPPRKIDVTKLKLRKVEAAVFAL
Predicted Coding Sequence 
XXGATTTTGAAGGCCCCACTCACTCATCACTATCCTCTCTTCCAACCATTTTTATCTTTCAATTTCTTCTCCCCTGTGCTGCACACACAG
AATCTTGAAATTAATAGCAACACAGAAGGAATGGTCTCTTTTGCTTCAACACTTCCCTCTTTGGTTTCATTCATTCCTTCACCATCTTCC
ATTACCAATGCCTCAAGAAACCCTCCTCAACCTGGTATGATTTGTTGTAAGTTTAGATCAGAGCTTAATAATGAAGATCGCTTTCATAGA
CGTGATATTCTTCAATCTGTTGGAGCAGCAGTAGGCATGGACTTGATAGCAAGATCGAGTGCATTCATCGAAGTAGCTAATGCTGCTGAT
TTAATACAACGCAGACAGCGGTCAGATTTTCAATCAAAGATCAAACTGACTCTTTATGATGCTATAAAGGCAAATCCGGATATAATTCCA
TCCTTACTAACTTTAGCACTTAACGATGCCATAACATATGATAAGGCAACAAAAACCGGGGGCCCAATGGATCCATACGTTTCAGCTCAG
AGATCAGCAGXACCAGAAAATAAGGGGCTTGATGCTGCTTTGAATTTGTTGGAGGAATCAAAGAAGGTTATTGATTTAGATTCCAAAGGT
GGACCAATCTCATATGCAGATCTCATCCAATTTGCTGCACAAAGTGCAGTCAAATCGACCTTTATCGCTTCTGCAATTAGCAAATGTGGT
GGTAATGTAGAGAAGGGGACTTTGTTGTACTCTGCATATGGTTCTAATGGACAGTGGGGCCAATTTGATAGGATATTCGGGAGGTCAGAT
GCCCAGGAGCCTGATCCAGAGGGAAGGGTGCCTCAGTGGGATAAAGCAAGTGTGCAGGAAATGAAAGACAAGTTCAAAGCTGTTGGCTTG
GGCCCTCGTCAGTTAGCAGTAATGTCTTCATTCTTGGGTCCTGATCAAGCTGCAACAGAGGCCCTACTCGCCAGTGATCCAGAAGTTCTT
CCTTGGATTCAGAAGTACCAAAGGAGCAGGGAAACAGTGTCTCGAACTGATTATGAGGTTGACTTGATTACTACTGTTACAAAATTAAGC
AGTTTGGGACAAGTAATAAACTATGAGGCATATACTTATCCTCCCAGGAAAATTGATGTTACCAAACTCAAGTTGAGAAAGGTGGAAGCT
GCAGTTTTTGCACTGTGA\
Edits in Original Sequence 
(5')XXGATTTTGAAGGCCCCACTCACTCATCACTATCCTCTCTTCCAACCATTTTTATCTTTCAATTTCTTCTCCCCTGTGCTGCACAC
ACAGAATCTTGAAATTAATAGCAACACAGAAGGAATGGTCTCTTTTGCTTCAACACTTCCCTCTTTGGTTTCATTCATTCCTTCACCATC
TTCCATTACCAATGCCTCAAGAAACCCTCCTCAACCTGGTATGATTTGTTGTAAGTTTAGATCAGAGCTTAATAATGAAGATCGCTTTCA
TAGACGTGATATTCTTCAATCTGTTGGAGCAGCAGTAGGCATGGACTTGATAGCAAGATCGAGTGCATTCATCGAAGTAGCTAATGCTGC
TGATTTAATACAACGCAGACAGCGGTCAGATTTTCAATCAAAGATCAAACTGACTCTTTATGATGCTATAAAGGCAAATCCGGATATAAT
TCCATCCTTACTAACTTTAGCACTTAACGATGCCATAACATATGATAAGGCAACAAAAACCGGGGGtCCCAATGGATCCATACGTTTCAG
CTCAGAGATCAGCAGXACCAGAAAATAAGGGGCTTGATGCTGCTTTGAATTTGTTGGAGGAATCAAAGAAGGTTATTGATTTAGATTCCA
AAGGTGGACCAATCTCATATGCAGATCTCATCCAATTTGCTGCACAAAGTGCAGTCAAATCGACCTTTATCGCTTCTGCAATTAGCAAAT
GTGGTGGTAATGTAGAGAAGGGGACTTTGTTGTACTCTGCATATGGTTCTAATGGACAGTGGGGCCAATTTGATAGGATATTCGGGAGGT
CAGATGCCCAGGAGCCTGATCCAGAGGGAAGGGTGCCTCAGTGGGATAAAGCAAGTGTGCAGGAAATGAAAGACAAGTTCAAAGCTGTTG
GCTTGGGCCCTCGTCAGTTAGCAGTAATGTCTTCATTCTTGGGTCCTGATCAAGCTGCAACAGAGGCCCTACTCGCCAGTGATCCAGAAG
TTCTTCCTTGGATTCAGAAGTACCAAAGGAGCAGGGAAACAGTGTCTCGAACTGATTATGAGGTTGACTTGATTACTACTGTTACAAAAT
TAAGCAGTTTGGGACAAGTAATAAACTATGAGGCATATACTTATCCTCCCAGGAAAATTGATGTTACCAAACTCAAGTTGtAGAAAGGTG
GAAGCTGCAGTTTTTGCACTGTGA\(3')ATGCACCGTGCACAACAGAGATAAATTTGCTTAATGGCAGATTAGTAACTGAGAGGTTTGA
GAATTTGTTTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan