ESTScan Details for Unigene SGN-U218881

Score 
1184
Direction 
Forward
Predicted Peptide Sequence 
HLSNFMVMDVXNVQGMMNNCWFRVKMNVCKPHKGEIGIVFEHPTQPGNQSGGWMAKERHLEISAVAPPTLKKSISTPFMNTASKMYSMSE
VRKHNSSDSAWIIVHGHIYDASRFLKDHPGGVDSILINAGTDCTEEFDAIHSDKAKKLLEDFRIGELITTGYTSDSSPNSSVHGSSSISS
FLAPIKELVQTPTRSVALIPREKIPCKLVDKQSISHDVRKFKFALPSEDQVLGLPVGKHIFLCATVDDKLCMRAYTPTSTVDEVGFFELV
VKIYFKGVHPKFPNGGQMSQHLDSLPIGAFLDVKGPLGHIEYQGKGNFLVHGKQKFAKKLAMIAGGTGITPVYQVMQSILKDPEDDTEMY
VVYANRTEDDILLKDELDAWAEQVPNRVKVWYVVQESITQGWKYSTGFVTESILREHIPEPSHTTLALACGPPPMIQFAINPNLEKMGYD
IKEELLGSKLDGDDDR
Predicted Coding Sequence 
XTACATTTGTCTAATTTTATGGTGATGGATGTTGXTAATGTTCAGGGAATGATGAACAATTGTTGGTTTCGAGTGAAGATGAATGTGTGC
AAACCTCACAAGGGAGAGATTGGTATAGTGTTTGAGCATCCGACTCAACCTGGAAATCAATCGGGTGGATGGATGGCAAAGGAGAGACAC
TTGGAGATATCAGCAGTGGCTCCTCCAACACTAAAGAAGAGTATATCAACTCCTTTCATGAACACAGCTTCGAAGATGTATTCCATGTCC
GAGGTGAGGAAACACAACTCTTCAGACTCTGCTTGGATCATAGTCCATGGACATATCTACGATGCCTCACGTTTCTTGAAAGACCATCCC
GGTGGTGTTGACAGCATTCTGATCAATGCTGGAACTGATTGTACTGAGGAATTTGATGCAATTCATTCTGATAAGGCTAAGAAGCTATTG
GAGGACTTTAGGATTGGTGAACTCATAACTACTGGTTACACGTCTGATTCGTCTCCAAACAGTTCTGTCCATGGATCCTCTTCGATCAGT
AGCTTCTTAGCACCTATTAAGGAGCTTGTTCAAACACCAACAAGGAGTGTAGCTCTCATCCCAAGGGAAAAAATCCCTTGCAAACTCGTC
GACAAGCAATCCATCTCCCATGATGTTAGGAAATTCAAATTTGCATTACCCTCTGAGGATCAAGTCTTAGGGTTACCTGTTGGCAAACAC
ATATTCCTCTGTGCCACAGTTGATGACAAACTCTGTATGCGTGCCTACACGCCTACTAGCACAGTCGATGAAGTAGGGTTCTTCGAGTTG
GTTGTCAAGATCTACTTCAAAGGTGTTCACCCTAAATTCCCTAATGGAGGTCAAATGTCACAACATCTTGATTCTCTCCCAATAGGTGCA
TTCCTTGACGTTAAAGGTCCATTAGGTCACATTGAATACCAAGGTAAGGGTAATTTCTTAGTCCATGGTAAACAAAAGTTTGCCAAGAAG
TTAGCTATGATAGCGGGTGGAACAGGTATAACTCCAGTATATCAAGTAATGCAATCAATATTGAAAGATCCTGAAGACGATACAGAGATG
TATGTGGTGTATGCAAACAGAACGGAGGATGATATTTTGCTCAAAGACGAACTTGATGCATGGGCAGAGCAAGTTCCAAATAGGGTTAAA
GTATGGTATGTCGTTCAAGAATCCATTACACAAGGATGGAAGTATAGTACAGGATTCGTTACAGAATCGATTCTTAGAGAACATATACCT
GAACCATCTCATACAACATTGGCATTAGCATGTGGACCACCTCCAATGATACAATTTGCTATTAATCCAAACTTGGAGAAAATGGGATAT
GACATTAAGGAGGAACTATTGGGTTCTAAATTGGATGGTGATGATGATAGATGA\
Edits in Original Sequence 
(5')XTACATTTGTCTAATTTTATGGTGATGGATGTTGXTAATGTTCAGGGAATGATGAACAATTGTTGGTTTCGAGTGAAGATGAATGT
GTGCAAACCTCACAAGGGAGAGATTGGTATAGTGTTTGAGCATCCGACTCAACCTGGAAATCAATCGGGTGGATGGATGGCAAAGGAGAG
ACACTTGGAGATATCAGCAGTGGCTCCTCCAACACTAAAGAAGAGTATATCAACTCCTTTCATGAACACAGCTTCGAAGATGTATTCCAT
GTCCGAGGTGAGGAAACACAACTCTTCAGACTCTGCTTGGATCATAGTCCATGGACATATCTACGATGCCTCACGTTTCTTGAAAGACCA
TCCCGGTGGTGTTGACAGCATTCTGATCAATGCTGGAACTGATTGTACTGAGGAATTTGATGCAATTCATTCTGATAAGGCTAAGAAGCT
ATTGGAGGACTTTAGGATTGGTGAACTCATAACTACTGGTTACACGTCTGATTCGTCTCCAAACAGTTCTGTCCATGGATCCTCTTCGAT
CAGTAGCTTCTTAGCACCTATTAAGGAGCTTGTTCAAACACCAACAAGGAGTGTAGCTCTCATCCCAAGGGAAAAAATCCCTTGCAAACT
CGTCGACAAGCAATCCATCTCCCATGATGTTAGGAAATTCAAATTTGCATTACCCTCTGAGGATCAAGTCTTAGGGTTACCTGTTGGCAA
ACACATATTCCTCTGTGCCACAGTTGATGACAAACTCTGTATGCGTGCCTACACGCCTACTAGCACAGTCGATGAAGTAGGGTTCTTCGA
GTTGGTTGTCAAGATCTACTTCAAAGGTGTTCACCCTAAATTCCCTAATGGAGGTCAAATGTCACAACATCTTGATTCTCTCCCAATAGG
TGCATTCCTTGACGTTAAAGGTCCATTAGGTCACATTGAATACCAAGGTAAGGGTAATTTCTTAGTCCATGGTAAACAAAAGTTTGCCAA
GAAGTTAGCTATGATAGCGGGTGGAACAGGTATAACTCCAGTATATCAAGTAATGCAATCAATATTGAAAGATCCTGAAGACGATACAGA
GATGTATGTGGTGTATGCAAACAGAACGGAGGATGATATTTTGCTCAAAGACGAACTTGATGCATGGGCAGAGCAAGTTCCAAATAGGGT
TAAAGTATGGTATGTCGTTCAAGAATCCATTACACAAGGATGGAAGTATAGTACAGGATTCGTTACAGAATCGATTCTTAGAGAACATAT
ACCTGAACCATCTCATACAACATTGGCATTAGCATGTGGACCACCTCCAATGATACAATTTGCTATTAATCCAAACTTGGAGAAAATGGG
ATATGACATTAAGGAGGAACTATTGGtGTTCTAAATTGGATGGTGATGATGATAGATGA\(3')TATATCTCTTTGGAGGAATAAATTCT
TTTGTATTTTCAGTTGTACATATTGTGTTTTTGTTTATCATCAAAATGTACTACTTCTTGTAGTTCTTACATTTTAATTTTCTACTCAAC
TTTAGGTATAAAATGTTGTACTGTGTACTAGTATGTGTATGTCAAAGTTAAGATTGTATTCATCATGGAATTACAGTAACTTTGTTGTCA
CAAGTCTTGTTGTAGAGATTTTTACCAAATTAATGTGTATATATATATAGTAAATTCCAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan