ESTScan Details for Unigene SGN-U219076

Score 
942
Direction 
Forward
Predicted Peptide Sequence 
MASSDHHMNDHHHHHHHDHDHNHEDTKATSWVGADGKVYHSHDGLAPHSHEPIYSPGYFSRRAPPLNDRNFSERAFTIGIGGPVGTGKTA
LMLALCKILREKYSLAAVTNDIFTKEDGEFLIKHGALPEERIRAVETGGCPHAAIREDISINLGPLEELSNLYKADILLCESGGDNLAAN
FSRELADYIIYIIDVSAGDKIPRKGGPGITQADLLVINKTDLAPAVGADLSVMERDALQMRDGGPFVFAQVKHGVGVEDIVNHILQSWEV
ATGNKKR
Predicted Coding Sequence 
ATGGCTTCTTCAGACCACCATATGAATGACCACCACCACCATCATCATCATGACCATGACCATAACCATGAGGACACAAAAGCGACATCA
TGGGTAGGAGCAGATGGGAAAGTATACCATAGTCATGATGGGTTGGCTCCTCACTCTCATGAACCTATTTATTCACCTGGCTACTTTAGC
AGAAGGGCACCTCCACTTAATGACAGGAATTTCAGTGAAAGAGCCTTTACTATTGGAATTGGTGGCCCTGTTGGTACTGGGAAAACAGCT
CTAATGCTGGCATTATGTAAAATCTTGAGGGAAAAATACAGTCTTGCAGCAGTAACAAATGATATATTCACGAAAGAAGATGGAGAGTTC
TTAATAAAACATGGTGCATTGCCGGAGGAAAGGATTCGAGCAGTGGAGACAGGAGGATGCCCACATGCTGCTATTAGGGAAGATATAAGC
ATTAACCTTGGACCTCTTGAGGAGCTTTCTAATTTGTACAAAGCAGATATACTACTCTGTGAATCTGGTGGAGACAACCTAGCTGCCAAC
TTCAGTAGGGAACTTGCTGACTACATAATCTACATAATAGATGTATCTGCGGGTGACAAAATTCCTCGAAAAGGAGGTCCCGGAATTACA
CAAGCAGATCTCCTTGTGATAAATAAGACCGACTTGGCACCAGCTGTGGGAGCAGATTTGTCCGTCATGGAGCGTGATGCACTTCAGATG
CGGGATGGTGGCCCTTTTGTTTTTGCTCAGGTGAAGCATGGGGTTGGCGTAGAGGACATAGTGAACCATATCTTACAATCCTGGGAAGTT
GCAACAGGCAATAAGAAGCGCTAA\
Edits in Original Sequence 
TTTTATCTCCCCTGTACCCTTGAGATACCCTCTTTGACTCTGAGAATCTCCACTCAA(5')ATGGCTTCTTCAGACCACCATATGAATGA
CCACCACCACCATCATCATCATGACCATGACCATAACCATGAGGACACAAAAGCGACATCATGGGTAGGAGCAGATGGGAAAGTATACCA
TAGTCATGATGGGTTGGCTCCTCACTCTCATGAACCTATTTATTCACCTGGCTACTTTAGCAGAAGGGCACCTCCACTTAATGACAGGAA
TTTCAGTGAAAGAGCCTTTACTATTGGAATTGGTGGCCCTGTTGGTACTGGGAAAACAGCTCTAATGCTGGCATTATGTAAAATCTTGAG
GGAAAAATACAGTCTTGCAGCAGTAACAAATGATATATTCACGAAAGAAGATGGAGAGTTCTTAATAAAACATGGTGCATTGCCGGAGGA
AAGGATTCGAGCAGTGGAGACAGGAGGATGCCCACATGCTGCTATTAGGGAAGATATAAGCATTAACCTTGGACCTCTTGAGGAGCTTTC
TAATTTGTACAAAGCAGATATACTACTCTGTGAATCTGGTGGAGACAACCTAGCTGCCAACTTCAGTAGGGAACTTGCTGACTACATAAT
CTACATAATAGATGTATCTGCGGGTGACAAAATTCCTCGAAAAGGAGGTCCCGGAATTACACAAGCAGATCTCCTTGTGATAAATAAGAC
CGACTTGGCACCAGCTGTGGGAGCAGATTTGTCCGTCATGGAGCGTGATGCACTTCAGATGCGGGATGGTGGCCCTTTTGTTTTTGCTCA
GGTGAAGCATGGGGTTGGCGTAGAGGACATAGTGAACCATATCTTACAATCCTGGGAAGTTGCAACAGGCAATAAGAAGCGCTAA\(3')
TTGAAAACTTCACTTGAACATTGTGGATCTTTTGGCTTATCCAGTGCTATTATATAACATTCAATTTCCCTGTTTCTGGACTAATATAAT
CTGTCTACTGAATAATGCTTGTTATGTACAAGCGCCTAGTATTTATAAGTTCCTATATTTAATTTGGTTTGTTTGATCAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan