ESTScan Details for Unigene SGN-U219086

Score 
251
Direction 
Forward
Predicted Peptide Sequence 
RNPKPRKASMATVPVNPKPFLNNLTGKPXDGKAEVGIRVQRVSGLCGFIYELAAANAEEFTDGVSSGSLGEILIRCNNVLYLRGVPEDEE
LEDADRD
Predicted Coding Sequence 
XTGAGAAACCCTAAACCTCGAAAAGCTTCAATGGCGACAGTACCAGTTAATCCGAAGCCTTTTTTGAACAATTTGACTGGAAAGCCTGXT
GATGGTAAAGCTGAAGTGGGGATTAGAGTACAAAGGGTATCTGGTCTCTGTGGATTCATATATGAACTTGCAGCTGCAAATGCAGAAGAA
TTCACTGATGGAGTAAGCTCTGGCTCTCTCGGAGAGATCCTGATTAGATGTAACAATGTCCTCTATCTTCGTGGTGTACCCGAGGATGAA
GAACTGGAAGATGCTGACCGCGACTAG\
Edits in Original Sequence 
(5')XTGAGAAACCCTAAACCTCGAAAAGCTTCAATGGCGACAGTACCAGTTAATCCGAAGCCTTTTTTGAACAATTTGACTGGAAAGCC
TGXTGATGGTAAAGCTGAAGTGGGGATTAGAGTACAAAGGGTATCTGGTCTCTGTGGATTCATATATGAACTTGCAGCtTGCAAATGCAG
AAGAATTCACTGATGGAGTAAGCTCTGGCTCTCTCGGAGAGATCCTGATTAGATGTAACAATGTCCTCTATCTTCGTGGTGTACCCGAGG
ATGAAGAACTGGAAGATGCTGACCGCGACTAG\(3')GAAGTGTATTAATAGTGACAAATTGATCAACGATTTGAATGTATCCCCGATTA
TGTGTTTTCTTAGGTGCTCCTTTCTGATATATGCTGTTGGTAGTCTGGTGAAAATATTGTTGACCAATGATTTACGGAGCAAAATGACTA
GAAAGCTGTATGATCTCCAGATTGCTTTATTTTTGTTATAATCACAAGCTTCAACTCGTATCATATAAAAAAAAATGATAGATTTTGTCC
AAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan