ESTScan Details for Unigene SGN-U219160

Score 
1157
Direction 
Forward
Predicted Peptide Sequence 
MEALGHGLLPLGAVGLVKKKEGVHLSVQSIFSAXPFPSTLKSLKYKNNTRMQAVEEEYELKQMKDMAAAKKRWDALIRDGTVKVLTPREA
GYAIQLSNKMLLDVRPSMERKKAWVKGSTWIPIFDVDASLELRTLSLKATNFLMGGWWSGVPALSYNKEFLSNVEEKFAKDTDLIVACQK
GLRSIAACEVLHNAGYNNIFWVQGGLEAAEEEDLEREGPQPFKFAGIGGLSEFLGWTDQQRDAAAKEGWGYRLTFSARLVGLVLGADALF
IGAQKVGQYLXDVKVSLRSAVAA
Predicted Coding Sequence 
ATGGAAGCTCTTGGTCATGGGCTCCTACCCCTTGGTGCTGTTGGACTTGTCAAAAAGAAGGAAGGTGTCCACTTATCGGTTCAATCCATT
TTCTCAGCTXCTCCATTCCCATCTACTCTAAAATCGTTAAAGTATAAAAATAACACAAGGATGCAAGCAGTGGAAGAAGAATATGAGTTG
AAGCAAATGAAAGATATGGCTGCGGCTAAGAAGAGATGGGATGCTCTGATCAGGGATGGGACAGTTAAGGTTCTTACTCCAAGGGAAGCT
GGTTATGCAATTCAACTCTCAAACAAAATGCTGCTTGATGTTCGTCCCTCTATGGAGCGAAAGAAGGCATGGGTAAAAGGCTCCACCTGG
ATTCCAATTTTTGATGTTGATGCTAGTTTAGAACTTCGTACTCTTTCCTTGAAAGCAACAAACTTTTTGATGGGAGGTTGGTGGAGTGGT
GTCCCTGCTCTTTCTTACAACAAAGAATTCTTATCAAATGTTGAGGAGAAATTTGCTAAAGATACAGATCTTATTGTGGCATGCCAGAAG
GGATTGAGGTCCATTGCGGCTTGTGAGGTGCTACACAATGCTGGTTACAACAACATTTTCTGGGTTCAAGGTGGTCTAGAAGCTGCTGAA
GAGGAGGATCTTGAAAGAGAAGGACCTCAACCATTCAAGTTCGCAGGAATTGGTGGGCTTTCAGAGTTCCTTGGATGGACTGACCAACAG
AGAGATGCTGCTGCTAAAGAGGGTTGGGGTTACCGATTGACTTTTTCTGCCCGGCTGGTTGGATTAGTTCTTGGTGCTGATGCCTTGTTT
ATTGGAGCACAAAAAGTAGGACAATATCTTCXAGATGTTAAGGTCTCACTGAGATCGGCTGTTGCAGCTTGA\
Edits in Original Sequence 
AAATAAAA(5')ATGGAAGCTCTTGGTCATGGGCTCCTACCCCTTGGTGCTGTTaGGACTTGTCAAAAAGAAGGAAGGTGTCCACTTATC
GGTTCAATCCATTTTCTCAGCTXCTCCATTCCCATCTACTCTAAAATCGTTAAAGTATAAAAATAACACAAGGATGCAAGCAGTGGAAGA
AGAATATGAGTTGAAGCAAATGAAAGATATGGCTGCGGCTAAGAAGAGATGGGATGCTCTGATCAGGGATGGGACAGTTAAGGTTCTTAC
TCCAAGGGAAGCTGGTTATGCAATTCAACTCTCAAACAAAATGCTGCTTGATGTTCGTCCCTCTATGGAGCGAAAGAAGGCATGGGTAAA
AGGCTCCACCTGGATTCCAATTTTTGATGTTGATGCTAGTTTAGAACTTCGTACTCTTTCCTTGAAAGCAACAAACTTTTTGATGGGAGG
TTGGTGGAGTGGTGTCCCTGCTCTTTCTTACAACAAAGAATTCTTATCAAATGTTGAGGAGAAATTTGCTAAAGATACAGATCTTATTGT
GGCATGCCAGAAGGGATTGAGGTCCATTGCGGCTTGTGAGGTGCTACACAATGCTGGTTACAACAACATTTTCTGGGTTCAAGGTGGTCT
AGAAGCTGCTGAAGAGGAGGATCTTGAAAGAGAAGGACCTCAACCATTCAAGTTCGCAGGAATTGGTGGGCTTTCAGAGTTCCTTGGATG
GACTGACCAACAGAGAGATGCTGCTGCTAAAGAGGGTTGGGGTTACCGATTGACTTTTTCTGCCCGGCTGGTTGGATTAGTTCTTGGTGC
TGATGCCTTGTTTATTGGAGCACAAAAAGTAGGACAATATCTTCXAGATGTTAAGGTCTCACTGAGATCGGCTGTTGCAGCTTGA\(3')
AGTTACATGCTGTGCAGCCACAAGGAAATGATTTTTCCTGAATCCAGGATATGTGTAAAGCGACTTCCCTAACATCCTTCATCTGAAGCT
AGAAGTGTGAGATGAAAATCCATTCTCAGGGCCCGGATTCCTTAAATGCCTTGTATTTCTTGGAAACATTTTTAAAGTGAGGTCATATAA
TGCAGCGACCTGACTTCAAAAATGTTGTTGATTCTAAATCTGTATTACTATATAGCTAGATCTGGGGATAACATCGAAATAAACCACTAT
CTTTCAAGTGAGTTTTCTTGCCCCCTATTTTGCATGAAAATACAATTGATGAGTATTTATTTGGATTATTGAATTCAAGTTTGCGTAATT
TACAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan