ESTScan Details for Unigene SGN-U219162

Score 
657
Direction 
Forward
Predicted Peptide Sequence 
MAAVDHRTRQQSNGKLSWLCPFTKSIFPAKRRLRLDPSNNLYFPYEPGKQAKSAIKIKNTSKSFVAFKFQTTAPKSCYMRPPGGILVPGE
SLIATVFKFIEQPENNEKPIDQKTKVKFKIISLKVKEGTDYVPELFDEQKDKVCIERTLKVVFLDPERPSPALDKLKRQLAQAEAATEAE
KKPPVDTGPKVVGEGLIVDEWKERRERYLARQQVEAXGFSKAVESVYVSASFSRIAMYNQYALLIIAFLWIDGVKVNAMLHVKKNTEWRF
KII
Predicted Coding Sequence 
ATGGCTGCCGTCGACCACCGCACGCGACAGCAGTCCAACGGCAAACTCTCGTGGCTTTGCCCCTTCACTAAATCCATATTTCCGGCTAAG
CGTCGGCTCCGGCTTGATCCTTCTAACAATCTCTACTTTCCATATGAACCTGGAAAGCAGGCGAAGAGTGCCATAAAGATTAAGAACACA
AGCAAATCTTTTGTAGCATTCAAGTTTCAAACTACTGCACCAAAGAGCTGCTACATGCGACCTCCGGGAGGTATTCTTGTACCTGGGGAA
AGTTTGATTGCCACTGTCTTCAAGTTTATTGAACAACCTGAGAACAATGAGAAGCCTATAGATCAAAAGACCAAAGTAAAGTTCAAGATC
ATAAGTTTGAAGGTGAAAGAAGGAACTGATTATGTACCTGAGTTGTTTGATGAACAAAAGGATAAAGTCTGTATTGAGCGTACTCTAAAG
GTGGTGTTCTTGGACCCTGAACGCCCTTCTCCAGCACTGGATAAACTAAAACGTCAGCTGGCCCAAGCTGAGGCTGCAACAGAAGCTGAG
AAGAAACCTCCTGTTGACACAGGTCCGAAAGTTGTGGGAGAAGGCTTAATAGTAGATGAATGGAAAGAGCGGAGGGAGAGGTATCTTGCT
CGCCAACAAGTTGAGGCAGXTGGATTCAGTAAAGCAGTAGAGAGTGTTTATGTAAGTGCGTCTTTTTCCAGAATAGCAATGTATAATCAG
TATGCACTTCTTATTATTGCCTTTCTTTGGATTGATGGTGTGAAGGTTAATGCAATGCTTCATGTAAAGAAGAACACTGAGTGGAGATTT
AAGATTATATAA\
Edits in Original Sequence 
TAAATTAAAGTCAACTTTTAGCTTCACTAAACGACAATATTCATTCCCCTAAATTTGTTTATGGCCTGAAATTGATAGTTATCATCGGAA
TACCACC
(5')ATGGCTGCCGTCGACCACCGCACGCGACAGCAGTCCAACGGCAAACTCTCGTGGCTTTGCCCCTTCACTAAATCCATAT
TTCCGGCTAAGCGTCGGCTCCGGCTTGATCCTTCTAACAATCTCTACTTTCCATATGAACCTGGAAAGCAGGCGAAGAGTGCCATAAAGA
TTAAGAACACAAGCAAATCTTTTGTAGCATTCAAGTTTCAAACTACTGCACCAAAGAGCTGCTACATGCGACCTCCGGGAGGTATTCTTG
TACCTGGGGAAAGTTTGATTGCCACTGTCTTCAAGTTTATTGAACAACCTGAGAACAATGAGAAGCCTATAGATCAAAAGACCAAAGTAA
AGTTCAAGATCATAAGTTTGAAGGTGAAAGAAGGAACTGATTATGTACCTGAGTTGTTTGATGAACAAAAGGATAAAGTCTGTATTGAGC
GTACTCTAAAGGTGGTGTTCTTGGACCCTGAACGCCCTTCTCCAGCACTGGATAAACTAAAACGTCAGCTGGCCCAAGCTGAGGCTGCAA
CAGAAGCTGAGAAGAAACCTCCTGTTGACACAGGTCCGAAAGTTGTGGGAGAAGGCTTAATAGTAGATGAATGGAAAGAGCGGAGGGAGA
GGTATCTTGCTCGCCAACAAGTTGAGGCAGXTGGATTCAGTAAAGCAGTAGAGAGTGTTTATGTAAGTGCGTCTTTTTCCAGAATAGCAA
TGTATAATCAGaTATGCACTTCTTATTATTGCCTTTCTTTGGATTGATGGTGTaGAAGGTTAATGCAATGCTTCATGTAAAGAAGAACAC
TGAGTGGAGATTTAAGATTATATAA\(3')GATTAGAAATAATTATATTCAGGAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan