ESTScan Details for Unigene SGN-U219196

Score 
126
Direction 
Forward
Predicted Peptide Sequence 
RGQAQHHNITLNPNLNPTICCVWKKSTEFSSYGLAGSVTRSLTSVARASTSRSSPPLTAFALLRSPALVPTRAASHSPVPGHWELWGXTQ
SFLPLHNVVAGTRLTSHLTVNGGLAAAVSWYLNTINGTAQSCLRFMVVLAG
Predicted Coding Sequence 
XTTCGTGGTCAAGCGCAGCACCATAACATAACCCTAAACCCTAATCTAAACCCAACAATTTGCTGTGTTTGGAAGAAATCAACAGAATTC
AGCAGCTATGGCTTGGCTGGTTCCGTCACCAGATCACTCACTTCCGTCGCTAGAGCTTCCACTTCCCGTTCATCTCCGCCGTTAACCGCG
TTCGCACTCCTCCGATCTCCGGCACTCGTTCCAACACGCGCCGCTTCTCATTCACCAGTCCCAGGACATTGGGAGCTTTGGGGTGXTACT
CAGTCATTTTTGCCTCTGCATAATGTGGTGGCTGGAACTCGATTGACTTCTCACTTGACAGTTAATGGCGGGCTTGCTGCAGCTGTATCA
TGGTACTTGAACACAATTAATGGAACAGCACAAAGTTGCTTGAGGTTTATGGTAGTCTTGGCGGGTTGA\
Edits in Original Sequence 
(5')XTTCGTGGTCAAGCGCAGCACCATAACATAACCCTAAACCCTAATCTAAACCCAACAATTTGCTGTGTTTGGAAGAAATCAACAGA
ATTCAGCAGCTATGGCTTGGCgTGGTTCCGTCACCAGATCACTCACTTCCGTCGCTAGAGCTTCCACTTCCCGTTCATCTCCGaCCGTTA
ACCGCGTTCGCACTCCTCCGATCTCCGGCACTCGTTCCAACACGCGCCGCTTCTCATTCACCAGTCCCAGGACATTGGGAGCTTTGGGGT
GXTACTCAGTCATTTTTGCCTCTGCATAATGTGGTGGCTGGAACTCGATTGACTTCTCACTTGACAGTTAATGtGCGGGCTTGCTGCgAG
CTGTATCATGGTACTTGAACACAATTAATGGAACAGCACAAAGTTGCTTGAGGTTTATGGTAGTCTTGGCGGGTTGA\(3')TGCATCTC
TGACAATCTGTTTTGGATGCAGAAAATAATAACTGTAATCTTTGTTTTTTCACATTCTAAAGATAAACTAGAAAATCTGTTTCCGACAGT
ATCATAGAGATTAAATTTATTTCAGTTAAGTGTTCATTTATATGCTTGGCCCATCTTATGTAAGCCATTTAAGATGCTTATTAAACATCC
TTTCTTCCGCAAAAAAAAATGATGTTAGAGTCAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan