ESTScan Details for Unigene SGN-U219208

Score 
439
Direction 
Forward
Predicted Peptide Sequence 
LIVVYQADVNAVHGQASLGSDCANSLNPRGGSADLSSDGFFDGCSLLHLACQTADIGMVELLLQHGANINACDLRGQIPLHHSFLRGRTE
IAKLLLSRGANPQAVDKEGKTPFHLVQESALDDXGDHCPAESCHRKHHNKDQTEVDNLVLHPSKNILSSRTKFGVIXEVLKLAQILSFIL
PAEIXVKAFEMKDPEKXLFLRESQRLGITIKYNMASCMSFVQNAVIFSAMHQAASVVFFIINSFATLVSFVIQVVQMLKVGSGAVVHVF
Predicted Coding Sequence 
CTCATTGTTGTTTATCAAGCAGATGTTAATGCAGTTCACGGGCAAGCATCACTTGGCAGTGATTGTGCGAACTCTTTGAACCCACGAGGT
GGAAGTGCAGACCTTTCCTCTGATGGATTTTTTGATGGCTGTTCCCTGCTTCACCTAGCCTGCCAAACTGCTGATATTGGCATGGTGGAG
CTGCTTCTGCAGCATGGCGCTAACATAAATGCTTGTGATTTGCGTGGTCAGATCCCACTGCATCATAGTTTCTTAAGAGGAAGAACTGAA
ATTGCCAAACTATTACTTTCAAGGGGGGCCAATCCACAAGCTGTCGATAAGGAAGGCAAGACTCCTTTCCACCTTGTCCAGGAATCAGCT
CTCGATGATGXTGGAGATCATTGCCCTGCTGAAAGTTGCCATAGGAAGCACCACAACAAAGATCAAACTGAGGTAGACAACTTAGTATTG
CATCCCAGTAAAAATATTTTATCTTCAAGAACGAAGTTTGGAGTTATACXGGAAGTGCTAAAGCTTGCTCAAATCCTTAGCTTCATTCTC
CCAGCAGAAATTXCTGTTAAGGCTTTTGAAATGAAAGATCCAGAGAAGXTGCTTTTTCTCCGCGAATCTCAGAGGTTAGGAATTACTATC
AAGTACAACATGGCTTCATGCATGTCATTTGTACAAAATGCAGTAATTTTCAGTGCGATGCATCAGGCTGCTTCTGTTGTGTTTTTCATT
ATTAATTCTTTTGCCACTTTGGTTTCTTTTGTCATCCAAGTTGTGCAGATGTTGAAAGTAGGCAGTGGAGCAGTTGTACATGTATTTTGA
\
Edits in Original Sequence 
(5')CTCATTGTTGTTTATCAAGCAGATGTTAATGCAGTTCACGGGCAAGCATCACTTGGCAGTGATTGTGCGAACTCTTTGAACCCACG
AGGTGGAAGTGCAGACCTTTCCTCTGATGGATTTTTTGATGGCTGTTCCCTGCTTCACCTAGCCTGCCAAACTGCTGATATTGGCATGGT
GGAGCTGCTTCTGCAGCATGGCGCTAACATAAATGCTTGTGATTTGCGTGGTCAGATCCCACTGCATCATAGTTTCTTAAGAGGAAGAAC
TGAAATTGCCAAACTATTACTTTCAAGGGGGGCCAATCCACAAGCTGTCGATAAGGAAGGCAAGACTCCTTTCCACCTTGTCCAGGAATC
AGCTCTCGATGATGXTGGAGATCATTGCCCTGCTGAAAGTTGCCATAGGAtAGCACCACAACAAAGATCAAACTGAGGTAGACAACTTAG
TATTGCATCCCAGTAAAAATATTTTATCTTCAAGAACGAAGTTTGGAGTTATACXGGAAGTGCTAAAGCTTGCTCAAATCCTTAGCTTCA
TTCTCCCAGCAGAAATTXCTGTTAAGGCTTTTGAAATGAAAGATCCAGAGAAGXTGCTTTTTCTCCGCGAATCTCAGAGGTTAGGAATTA
CaTATCAAGTACAACATGGCTTCATGCATGTCATTTGTACAAAATGCAGTAATTTTCAGTGCGATGCATCAGGCTGCTTCTGTTGTGTTT
TTCATTATTAATTCTTTTGCCACTTTGGTTTCTTTTGTCATCCAAGTTGTGCAGATGTTGAAAGTAGGCAGTGGAGCAGTTGTACATGTA
TTTTGA\(3')ATTGACTGTGAAACAGAATTAGCTAAGTAGAACTATATTTAAGTGGGAAATTGGCTCAGTGATGAAGCTGAAAGAAATT
GGGGAGACGTGATGAATGAGGCTATTTATTATGGTTTCATTTTAGAGGAGTAAGAAAGAATGTTTATCACCAATAGGCAATATATAGATT
TCTTGTATTTGAAAACTATTTGTATTGCAATAAGAATTGTAAATATAAAATAAAGAACACAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan