ESTScan Details for Unigene SGN-U219332

Score 
525
Direction 
Forward
Predicted Peptide Sequence 
DSIKIRFYFALGNQTYKIHVQIRLLRIENSEICLILKMTTEQLLLSIDPLDLKFPFELNKPVSTAFQLINKTDNHVAFKVKTTNPRKYTV
RPNSGIVLPRSRSNVTVTMQPQMELPPGMQCKDKFLVQSVIVDPGSTAKDINPDMFNKSGVNDVEECKLKVIYVSPPRKPSPVPEDSEEG
TSPTASDSDLQEDSEPQDNSIKARDLILRLMEERDSILRENAKLSRDLELLRHGRHERRTGVRLLYILLVGLGSILLGFIVKKFDDLTAR
DYTLAFWLLWTGVRGDLNTF
Predicted Coding Sequence 
XCTGATTCCATCAAAATAAGATTCTATTTTGCATTGGGAAACCAAACTTATAAAATTCATGTTCAAATTCGTCTCTTGAGAATTGAGAAT
TCAGAAATTTGTTTGATTTTGAAGATGACAACTGAACAACTACTTCTAAGTATCGATCCTTTGGACCTCAAATTTCCATTTGAACTCAAC
AAGCCAGTTTCGACCGCTTTTCAACTCATCAATAAGACTGATAATCATGTTGCTTTCAAGGTAAAGACGACCAATCCCAGAAAGTATACT
GTTAGGCCGAACAGTGGAATTGTTCTCCCACGATCAAGGTCCAATGTTACAGTTACGATGCAACCTCAAATGGAGTTACCTCCAGGTATG
CAATGCAAAGACAAGTTTCTTGTACAGAGTGTGATTGTGGACCCTGGGTCTACAGCAAAAGATATTAACCCAGACATGTTCAACAAGTCC
GGGGTAAATGATGTTGAGGAATGCAAACTAAAAGTTATTTATGTCTCACCACCGCGAAAACCATCACCAGTCCCTGAAGATTCTGAGGAA
GGAACTTCACCAACAGCTTCTGACAGTGATTTACAAGAAGACAGTGAGCCTCAGGACAACTCCATTAAGGCCAGAGATCTCATTTTGAGG
TTGATGGAAGAGAGAGACTCCATTCTTCGAGAAAATGCTAAACTCAGCCGAGACCTGGAGCTTCTGAGGCATGGACGTCATGAACGTCGT
ACTGGAGTTCGACTTTTGTACATCTTGCTGGTTGGCTTGGGTAGTATTCTTTTGGGGTTCATTGTCAAAAAGTTTGATGACCTCACAGCT
CGAGATTATACTCTCGCTTTCTGGTTGCTGTGGACAGGTGTGAGGGGTGATTTGAATACTTTCTAA\
Edits in Original Sequence 
(5')XCTGATTCCATCAAAATAAGATTCTATTTTGCATTGGGAAACgCAAACTTATAAAATTCATGTTCAAATTCGTCTCTTGAGAATTG
AGAATTCAGAAATTTGTTTGATTTTGAAGATGACAACTGAACAACTACTTCTAAGTATCGATCCTTTGGACCTCAAATTTCCATTTGAAC
TCAACAAGCCAGTTTCGACCGCTTTTCAACTCATCAATAAGACTGATAATCATGTTGCTTTCAAGGTAAAGACGACCAATCCCAGAAAGT
ATACTGTTAGGCCGAACAGTGGAATTGTTCTCCCACGATCAAGGTCCAATGTTACAGTTACGATGCAACCTCAAATGGAGTTACCTCCAG
GTATGCAATGCAAAGACAAGTTTCTTGTACAGAGTGTGATTGTGGACCCTGGGTCTACAGCAAAAGATATTAACCCAGACATGTTCAACA
AGTCCGGGGTAAATGATGTTGAGGAATGCAAACTAAAAGTTATTTATGTCTCACCACCGCGAAAACCATCACCAGTCCCTGAAGATTCTG
AGGAAGGAACTTCACCAACAGCTTCTGACAGTGATTTACAAGAAGACAGTGAGCCTCAGGACAACTCCATTAAGGCCAGAGATCTCATTT
TGAGGTTGATGGAAGAGAGAGACTCCATTCTTCGAGAAAATGCTAAACTCAGCCGAGACCTGGAGCTTCTGAGGCATGGACGTCATGAAC
GTCGTACTGGAGTTCGACTTTTGTACATCTTGCTGGTTGGCTTGGGTAGTATTCTTTTGGGGTTCATTGTCAgAAAAGTTTGATGACCTC
ACAGCTCGAGATTATACTCTCGCTTTCTGGTTGCTGTGGACAGGTGTGAGGGGTGATTTGAATACTTTCTAA\(3')GAGAACTTTTGTA
CATCTTTTTGAGTCTGAACTGCTTGCTAATTCTAAAGTATATTAGTTGAATATTATTAATGTCTTAGAATGATTGTAACTATAGTTGTGG
ACTTGTGGTCCTAGCTTTGCTTTTATGAGGCAAATCAAAAGGAAGAAAAGAAGAAAAGTTACATCACAGCTTGAAGCATCACAATGAATA
TCCATACCTTGGTCTTCATACTCACTGTCATGGGGCCAACCATTCCTACGAATGTGTTCATGCTGAATTATGCAGCGATTGGGTTTTTGT
CCCAACACTAAAGGATTTTTCACCCAAATATATGTCAAGATTTCGACTTAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan