ESTScan Details for Unigene SGN-U219463

Score 
706
Direction 
Forward
Predicted Peptide Sequence 
MQGQQNTVGSLQETLGFNHGSTPSEGGVDQQICWSNLQNSAQNHLPDYMVSSNATDIPFFNPMSQERQNVTRGSLGESSSSIAPNSASWS
EQKADHGWSSAMTTYNGPSLICNEQQCGSSNIMSLNDFFSQGSSSSTIPHEINRNPAFEGRSDNNDDGCQVMECTPYNSVRPGKERMSSA
CTYLGNGCSTDDSGDGRPESSPDSRRFCKRKTLEGYLAQSSGSGSSDYIPLAENSIWHSGTTSHSMSTGANISAPTESVRSINMSEHVIP
RLGLTMGGAVAVTPVGTPASRSAESSHRNFRVRIDGSPQQDYLPSNIFPDVDNVGNVNRSSEQQLPELLPNIPLDLRSVPAADSGNTQRQ
PVVMHASSLHRRAQTGGVQHQVPELAAHQVLXRERNSVTFEEPNSRIVSRNISQHPMFIPSTNGRNLNQNPASLNLAGRNVSVAGN
Predicted Coding Sequence 
ATGCAGGGGCAACAGAATACCGTTGGTTCGCTCCAAGAAACTTTAGGTTTTAATCATGGTTCGACGCCTAGTGAAGGTGGTGTAGATCAA
CAGATATGTTGGAGTAATTTGCAAAATTCTGCACAGAATCACCTGCCTGATTATATGGTTTCTTCAAATGCGACTGATATTCCATTCTTC
AATCCTATGAGCCAAGAGAGACAGAATGTAACCAGGGGGAGTTTAGGAGAATCCAGCTCCTCTATTGCACCGAATTCTGCAAGTTGGAGT
GAACAGAAAGCAGATCATGGATGGTCATCCGCAATGACTACATATAATGGACCTTCACTAATCTGTAATGAACAGCAATGTGGGTCTTCT
AACATTATGTCATTGAATGATTTTTTTTCTCAAGGTTCTAGTTCTAGCACCATTCCTCATGAAATCAACAGGAATCCAGCATTTGAGGGG
CGCAGTGACAACAATGACGATGGCTGTCAAGTGATGGAGTGTACTCCATACAATTCTGTTAGACCAGGAAAAGAGCGAATGTCATCTGCT
TGTACTTATTTAGGTAATGGGTGTTCGACGGATGATAGTGGTGATGGCAGGCCAGAAAGTTCACCGGATTCTAGGCGCTTTTGTAAGAGA
AAAACACTTGAAGGATATCTAGCACAATCTTCAGGAAGTGGAAGTTCTGATTATATTCCTCTTGCTGAAAATAGCATATGGCATTCTGGA
ACTACATCACATAGTATGAGTACAGGTGCAAATATCTCTGCTCCAACTGAAAGTGTCAGAAGCATCAATATGTCTGAGCATGTGATTCCA
AGACTTGGGCTTACCATGGGAGGAGCCGTTGCGGTAACTCCCGTTGGTACTCCGGCTTCAAGAAGTGCAGAAAGTTCTCATAGAAATTTC
AGGGTGAGGATTGATGGCTCACCTCAGCAAGATTATCTTCCCAGTAATATCTTTCCTGATGTGGATAATGTTGGAAATGTTAATCGGTCA
TCTGAACAGCAATTACCAGAGTTACTTCCTAATATCCCTTTGGATTTGAGGTCTGTGCCTGCTGCAGACAGTGGAAATACTCAAAGGCAG
CCTGTTGTAATGCATGCTTCGTCTCTGCATCGACGTGCACAGACTGGTGGAGTTCAGCATCAAGTTCCAGAACTGGCAGCTCATCAAGTT
CTGCXGCGAGAGAGAAATTCAGTAACATTTGAAGAGCCTAACTCAAGAATTGTGTCAAGAAACATCTCACAACATCCTATGTTCATACCT
TCAACTAATGGGAGAAACTTGAACCAAAATCCTGCCAGCTTGAATTTAGCTGGAAGAAATGTTTCTGTTGCTGGAAAT\
Edits in Original Sequence 
TTTCATTTCCTCTTTTCTCCACCCCATCTCTCAAAATCCCTTCTTTCTCTCTCTCTTCTCTGTTAAGCAGTTGGTTTACATAGATTTGAT
GTTTCTTCTGGTTGCTGTTTCACTGGTTTGCTAAGGAAAAAGTGTGAATCTTCTCACACTACAATACTATCTCAAATCCTCTTTGAGACT
GTAAGCTTGGTATACCATAGCTCTA
(5')ATGCAGGGGCAACAGAATACCGTTGGTTCGCTCCAAGAAACTTTAGGTTTTAATCATGGTT
CGACGCCTAGTGAAGGTGGTGTAGATCAACAGATATGTTGGAGTAATTTGCAAAATTCTGCACAGAATCACCTGCCTGATTATATGGTTT
CTTCAAATGCGACTGATATTCCATTCTTCAATCCTATGAGCCAAGAGAGACAGAATGTAACCAGGGGGAGTTTAGGAGAATCCAGCTCCT
CTATTGCACCGAATTCTGCAAGTTGGAGTGAACAGAAAGCAGATCATGGATGGTCATCCGCAATGACTACATATAATGGACCTTCACTAA
TCTGTAATGAACAGCAATGTGGGTCTTCTAACATTATGTCATTGAATGATTTTTTTTCTCAAGGTTCTAGTTCTAGCACCATTCCTCATG
AAATCAACAGGAATCCAGCATTTGAGGGGCGCAGTGACAACAATGACGATGGCTGTCAAGTGATGGAGTGTACTCCATACAATTCTGTTA
GACCAGGAAAAGAGCGAATGTCATCTGCTTGTACTTATTTAGGTAATGGGTGTTCGACGGATGATAGTGGTGATGGCAGGCCAGAAAGTT
CACCGGATTCTAGGCGCTTTTGTAAGAGAAAAACACTTGAAGGATATCTAGCACAATCTTCAGGAAGTGGAAGTTCTGATTATATTCCTC
TTGCTGAAAATAGCATATGGCATTCTGGAACTACATCACATAGTATGAGTACAGGTGCAAATATCTCTGCTCCAACTGAAAGTGTCAGAA
GCATCAATATGTCTGAGCATGTGATTCCAAGACTTGGGCTTACCATGGGAGGAGCCGTTGCGGTAACTCCCGTTGGTACTCCGGCTTCAA
GAAGTGCAGAAAGTTCTCATAGAAATTTCAGGGTGAGGATTGATGGCTCACCTCAGCAAGATTATCTTCCCAGTAATATCTTTCCTGATG
TGGATAATGTTGGAAATGTTAATCGGTCATCTGAACAGCAATTACCAGAGTTACTTCCTAATATCCCTTTGGATTTGAGGTCTGTGCCTG
CTGCAGACAGTGGAAATACTCAAAGGCAGCCTGTTGTAATGCATGCTTCGTCTCTGCATCGACGTGCACAGACTaGGTGGAGTTCAGCAT
CAAGTTCCAGAACTGGCAGCTCATCAAGTTCTGCXGCGAGAGAGAAATTCAGTAACATTTGAAGAGCCTAACTCAAGAATTGTGTCAAGA
AACATCTCACAACATCCTATGTTCATACCTTCAACTAATGGGAGAAACTTGAACCAAAATCCTGCCAGCTTGAATTTAGCTGGAAGAAAT
GTTTCTGTTGCTGGAAAT\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan