ESTScan Details for Unigene SGN-U219505

Score 
902
Direction 
Forward
Predicted Peptide Sequence 
MEAVVVDAGSKFLKAGFAIPDQTPAMVIPTQMKRIAEDDEGSLFEEEEVAVDPIERGFVKDWDAMEDLLHHVLYSGLGWEIGNEGQILFT
DPLCTPKAIREQLVQLMFETFNISGFYASEQAVLSLYAVGRISGCTVDVGHGKIDIAPVIEGAVQHIASRRLEVGGLDLTKLLADELSKS
NPTVKLNISDVEKLKEQYACCADDDIAYXEASTLLPAREHTLPDGQVITIGKEDTLLERHCFTIYIRHDTHG
Predicted Coding Sequence 
ATGGAGGCAGTAGTAGTGGATGCTGGTTCTAAATTTCTCAAAGCTGGTTTCGCTATTCCAGATCAAACTCCTGCTATGGTAATACCAACC
CAAATGAAACGCATTGCTGAAGATGATGAAGGTTCCTTGTTTGAGGAGGAGGAAGTGGCTGTGGATCCCATTGAGAGGGGTTTCGTTAAA
GATTGGGATGCAATGGAAGACCTGTTGCATCATGTTCTTTATTCTGGTCTTGGTTGGGAAATTGGAAATGAAGGTCAAATTTTGTTCACT
GACCCGCTCTGCACTCCCAAGGCTATTAGGGAACAATTGGTGCAGTTGATGTTTGAAACATTCAACATCTCGGGGTTTTATGCCTCTGAG
CAGGCAGTACTGTCGCTTTATGCAGTTGGACGCATATCTGGCTGTACTGTTGATGTTGGTCATGGGAAAATTGATATTGCACCTGTCATT
GAGGGTGCTGTTCAGCACATAGCATCAAGAAGGTTGGAAGTTGGGGGATTGGATTTGACAAAGCTACTAGCAGATGAGCTTAGTAAATCA
AATCCCACAGTGAAACTCAATATTTCTGATGTTGAAAAATTGAAAGAGCAGTATGCATGCTGTGCTGATGATGATATTGCCTATGAXGAA
GCTTCAACACTCTTGCCTGCAAGAGAACATACTCTGCCTGATGGCCAGGTAATCACAATTGGAAAAGAAGATACACTGTTGGAGAGGCAT
TGTTTCACCATCTATATTAGGCATGATACTCATGGA\
Edits in Original Sequence 
AAATTACATACCAAAATATGAAAAAAAAAATATAAAAATGAAGAGTGAATAAAGATGAAAAGGGGAAGAAAATAAAAGAGGTGGGAATAG
CAGCAAATTCAATTTTCAGTTCTTGAATTTTAATTTACTCAGAAAAGAGAAAGAGAGAACAATTTCTCAGAGCTTTCAACA
(5')ATGGA
GGCAGTAGTAGTGGATGCTGGTTCTAAATTTCTCAAAGCTGGTTTCGCTATTCCAGATCAAACTCCTGCTATGGTAATACCAACCCAAAT
GAAACGCATTGCTGAAGATGATGAAGGTTCCTTGTTTGAGGAGGAGGAAGTGGCTGTGGATCCCATTGAGAGGGGTTTCGTTAAAGATTG
GGATGCAATGGAAGACCTGTTGCATCATGTTCTTTATTCTGGTCTTGGTTGGGAAATTGGAAATGAAGGTCAAATTTTGTTCACTGACCC
GCTCTGCACTCCCAAGGCTATTAGGGAACAATTGGTGCAGTTGATGTTTGAAACATTCAACATCTCGGGGTTTTATGCCTCTGAGCAGGC
AGTACTGTCGCTTTATGCAGTTGGACGCATATCTGGCTGTACTGTTGATGTTGGTCATGGGAAAATTGATATTGCACCTGTCATTGAGGG
TGCTGTTCAGCACATAGCATCAAGAAGGTTGGAAGTTGGGGGATTGGATTTGACAAAGCTACTAGCAGATGAGCTTAGTAAATCAAATCC
CACAGTGAAACTCAATATTTCTGATGTTGAAAAATTGAAAGAGCAGTATGCATGCTGTGCTGATGATGATATTGCCTATGAXGAAGCTTC
AACACTCTTGCCTGCAAGAGAACATACTCTGCCTGATGGCCAGGTAATCACAATTGGAAAAGAAGATACACTGTTGGAGAGGCATTGTTT
CACCATCTATATTAGGCATGATACTCATGGA\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan