ESTScan Details for Unigene SGN-U219515

Score 
233
Direction 
Reverse
Predicted Peptide Sequence 
MRITKGPPSLSRQYSTNIESPKPELEKXNLELKTPQQGVGKRCLGRSEKEKKETEEGNAGKGPTAIIYEQHMNWPESHISPTDKDYMSLT
SLQFADISPEALKDCTLGXVKVMLTGPASLVIFPCDSCENVSLARNVWSDPPTT
Predicted Coding Sequence 
ATGAGAATCACCAAAGGCCCTCCATCATTATCTAGACAATATAGTACAAACATTGAAAGCCCAAAACCAGAGTTAGAAAAGAXCAATTTA
GAACTCAAGACACCTCAACAGGGAGTGGGCAAAAGATGTTTAGGAAGAAGTGAAAAAGAGAAGAAAGAAACCGAGGAGGGTAATGCTGGA
AAAGGTCCAACAGCCATCATATACGAGCAACATATGAATTGGCCTGAGTCACATATCTCACCCACCGATAAGGATTATATGTCTTTGACT
TCTTTGCAATTTGCAGATATTTCACCTGAAGCCTTGAAGGATTGTACATTGGGAXTTGTGAAGGTCATGCTCACTGGTCCAGCTTCCTTG
GTGATATTTCCATGTGACTCTTGTGAAAATGTTAGCTTGGCACGTAATGTATGGTCTGATCCACCGACAACX\
Edits in Original Sequence 
TTTTTTTTTTTTTTAAATAGCAAAATTTTCCATTAGTTGCACAATTTTTTAAA(5')ATGAGAATCACCAAAGaGCCCTCCATCATTATC
TAGACAATATAGTACAAACATTGAAAGCCCAAAACCAGAGTTAGAAAAGAXCAATTTAGAACTCAAGACACCTCAACAGGGAGTGGGCAA
AAGATGTTTAGGAAGAAGTGAAAAAGAGAAGAAAGAAACCGAGGAGGGTAATGCTGGAAAAGGTCtCAACAGCCATCATATACGAGCAAC
ATATGAATTGGCCTGAGTCACATATCTCACCCACCGATAAGGATTATATGTCTTTGACTTCTTTGCAATTTGCAGATATTTCACCTGAAG
CCTTGAAGGATTGTACATTGGGAXTTGTGAAGGTCATGCTCACTGGTCCAGCTTCCTTGGTGATATTTCCATGTGACTCTTGTGAAAATG
TTAGCTTGGCACGTAATGTATGGTCTGATCCACCGACAACX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan