ESTScan Details for Unigene SGN-U219631

Score 
1275
Direction 
Forward
Predicted Peptide Sequence 
MAIDYMITRNNNMISKEDQVSNKSLSFNASLMKNESNIPSQFIWPDHEKPNYASVTRELQVPLIDLSGVLSNDPIEIKKATRLVNEACTK
HGFFLVVNHGVDTNLIKNAHVYIDKFFQLPLCEKQKAQRKVGEHCGYASSFVGRFSSKLPWKETLSFQYSDQKGSSHIVEDYFQRTLGEK
FSYIGKVYQEYCNAVSTLSLGIMELLGLSLGVSKNHFKEFFQGNESIMRLNYYPTCQKPELTLGTGPHCDPTSLTILHQDSVGGLQVFVD
NEWHTITPNFNAFVVNIGDTFMALSNGRYKSCLHRAVVNNKIPRKSLAFFLCPKKDKVITPPNELVDSNNPRIYPDFTWPTLLEFTQKQY
RADMNTLQTFSNWLKKTQS
Predicted Coding Sequence 
ATGGCAATTGATTATATGATCACGAGAAATAACAACATGATATCCAAAGAAGATCAAGTATCAAATAAGTCGTTGAGTTTTAATGCATCA
TTGATGAAAAACGAGTCAAATATACCAAGCCAATTCATATGGCCGGACCATGAGAAGCCAAATTATGCTAGTGTTACTAGAGAACTACAA
GTTCCACTAATAGACTTAAGTGGGGTACTTTCAAATGACCCTATTGAAATCAAGAAAGCAACTAGACTTGTTAATGAAGCATGTACAAAA
CATGGTTTTTTCTTAGTGGTTAACCATGGGGTTGACACAAATCTCATAAAAAATGCACATGTTTACATAGACAAGTTCTTTCAATTGCCA
CTTTGTGAGAAGCAAAAAGCACAAAGAAAAGTTGGTGAACATTGTGGTTATGCTAGTAGCTTTGTTGGAAGGTTTTCATCTAAGTTGCCT
TGGAAAGAAACACTCTCGTTTCAATACTCTGATCAGAAAGGCTCATCACACATAGTTGAAGATTATTTTCAAAGGACACTCGGTGAAAAA
TTTAGTTATATTGGGAAGGTTTATCAAGAATATTGCAATGCCGTGAGCACCCTTTCTCTAGGGATCATGGAACTTTTGGGATTGAGCCTA
GGTGTGAGCAAGAACCACTTCAAAGAATTCTTTCAAGGAAATGAGTCCATAATGAGACTAAATTATTATCCAACATGTCAAAAACCTGAA
CTCACTTTAGGGACAGGGCCTCATTGTGATCCCACATCATTAACCATTCTCCATCAAGATAGTGTTGGTGGGCTTCAAGTTTTTGTGGAT
AATGAGTGGCACACCATCACTCCAAATTTCAACGCTTTTGTTGTTAACATAGGCGACACGTTTATGGCACTATCAAACGGAAGATACAAA
AGTTGCTTGCATAGAGCAGTGGTAAACAACAAAATACCTAGGAAATCACTTGCTTTTTTTCTTTGTCCCAAGAAAGATAAGGTGATTACT
CCACCAAATGAATTAGTGGATTCTAACAATCCAAGAATTTATCCAGATTTCACATGGCCAACCTTATTAGAATTTACACAAAAACAATAT
AGAGCTGATATGAACACCCTACAAACTTTCTCAAATTGGCTTAAAAAAACACAGTCTTAA\
Edits in Original Sequence 
GAAAATTTTATAAGTTACATGCAACATA(5')ATGGCAATTGATTATATGATCACGAGAAATAACAACATGATATCCAAAGAAGATCAAG
TATCAAATAAGTCGTTGAGTTTTAATGCATCATTGATGAAAAACGAGTCAAATATACCAAGCCAATTCATATGGCCGGACCATGAGAAGC
CAAATTATGCTAGTGTTACTAGAGAACTACAAGTTCCACTAATAGACTTAAGTGGGGTACTTTCAAATGACCCTATTGAAATCAAGAAAG
CAACTAGACTTGTTAATGAAGCATGTACAAAACATGGTTTTTTCTTAGTGGTTAACCATGGGGTTGACACAAATCTCATAAAAAATGCAC
ATGTTTACATAGACAAGTTCTTTCAATTGCCACTTTGTGAGAAGCAAAAAGCACAAAGAAAAGTTGGTGAACATTGTGGTTATGCTAGTA
GCTTTGTTGGAAGGTTTTCATCTAAGTTGCCTTGGAAAGAAACACTCTCGTTTCAATACTCTGATCAGAAAGGCTCATCACACATAGTTG
AAGATTATTTTCAAAGGACACTCGGTGAAAAATTTAGTTATATTGGGAAGGTTTATCAAGAATATTGCAATGCCGTGAGCACCCTTTCTC
TAGGGATCATGGAACTTTTGGGATTGAGCCTAGGTGTGAGCAAGAACCACTTCAAAGAATTCTTTCAAGGAAATGAGTCCATAATGAGAC
TAAATTATTATCCAACATGTCAAAAACCTGAACTCACTTTAGGGACAGGGCCTCATTGTGATCCCACATCATTAACCATTCTCCATCAAG
ATAGTGTTGGTGGGCTTCAAGTTTTTGTGGATAATGAGTGGCACACCATCACTCCAAATTTCAACGCTTTTGTTGTTAACATAGGCGACA
CGTTTATGGCACTATCAAACGGAAGATACAAAAGTTGCTTGCATAGAGCAGTGGTAAACAACAAAATACCTAGGAAATCACTTGCTTTTT
TTCTTTGTCCCAAGAAAGATAAGGTGATTACTCCACCAAATGAATTAGTGGATTCTAACAATCCAAGAATTTATCCAGATTTCACATGGC
CAACCTTATTAGAATTTACACAAAAACAATATAGAGCTGATATGAACACCCTACAAACTTTCTCAAATTGGCTTAAAAAAACACAGTCTT
AA\(3')ATATATCATCAACAAACATCTTTGTAAACTTGTTGTACATGCTTTGATGTGGACATAGAAATGGAACCTCATGGGGAGGGGTG
GGGGGTTAGTAATTGTATGAATGATCAATTTTGTAATTTATTTGACTCATGAAATAAAAACTATGATTAGTTTTATATCTTTATAAAAAA
AAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan