ESTScan Details for Unigene SGN-U219669

Score 
506
Direction 
Forward
Predicted Peptide Sequence 
MASKPQRIRHLVGATWQSAMKKARTMSTETHTESSMKDGFSKYAEYLNNLNDKRERVVKASRDITMNSKKVIFQVHRMSKQNKEEVLDKA
VKDLAAVTDQYLSPAVKELQGTDFWKLRRAYSPGVQEYVEAATLCNFCKTGTLLTLDEMNATLLPLSDPSVEPLQINILDYILGLADLTG
ELMRLAIGRISEGELDFAEKICSFVREIYRNLTLIAPEMDDSSDMKQKMENMLQSVMKIENACF
Predicted Coding Sequence 
ATGGCTTCAAAACCCCAGCGCATTCGTCACTTGGTGGGAGCAACTTGGCAAAGCGCAATGAAGAAGGCGAGAACCATGAGTACTGAAACT
CACACTGAATCATCAATGAAAGATGGCTTCTCTAAATATGCTGAGTACCTCAATAACCTGAATGATAAACGAGAAAGGGTGGTTAAAGCC
AGCCGTGATATTACTATGAACAGCAAGAAGGTCATTTTTCAAGTGCACAGAATGAGCAAGCAGAACAAAGAGGAAGTTCTGGATAAAGCA
GTAAAAGATTTGGCAGCTGTGACTGATCAATATTTGTCXCCGGCTGTTAAGGAACTGCAAGGGACTGATTTCTGGAAGCTAAGACGAGCA
TATTCTCCTGGGGTTCAAGAATATGTTGAAGCTGCAACACTTTGTAATTTCTGCAAGACAGGGACTCTATTAACTCTTGATGAGATGAAT
GCGACCTTGCTCCCATTAAGTGATCCTTCTGTTGAACCCTTGCAGATTAACATCTTAGACTATATCTTAGGGCTTGCGGACTTGACAGGA
GAATTAATGAGGTTAGCAATCGGTCGAATTTCAGAAGGGGAACTTGATTTTGCAGAGAAGATCTGCAGTTTTGTGCGTGAAATTTACAGG
AACCTTACTCTTATTGCCCCAGAGATGGATGATAGTTCAGACATGAAACAGAAAATGGAAAACATGCTCCAGAGTGTGATGAAGATAGAA
AATGCTTGTTTT\
Edits in Original Sequence 
TTATGTTTCATAGTT(5')ATGGCTTCAAAACCCCAGCGCATTCGTCACTTGGTGGGAGCAACTTGGCAAAGCGCAATGAAGAAGGCGAG
AACCATGAGTACTGAAACTCACACTGAATCATCAATGAAAGATGGCTTCTCTAAATATGCTGAGTACCTCAATAACCTGAATGATAAACG
AGAAAGGGTGGTTAAAGCCAGCCGTGATATTACTATGAACAGCAAGAAGGTCATTTTTCAAGTGCACAGAATGAGCAAGCAGAACAAAGA
GGAAGTTCTGGATAAAGCAGTAAAAGATTTGGCAGCTGTGACTGATCAATATTTGTCXCCGGCTaGTTAAGGAACTGCAAGGGACTGATT
TCTGGAAGCTAAGACGAGCATATTCTCCTGGGGTTCAAGAATATGTTGAAGCTGCAACACTTTGTAATTTCTGCAAGACAGGGACTCTAT
TAACTCTTGATGAGATGAATGCGACCTTGCTCCCATTAAGTGATCCTTCTGTTGAACCCTTGCAGATTAACATCTTAGACTATATCTTAG
GGCTTGCGGACTTGACAGGAGAATTAATGAGGTTAGCAATCGGTCGAATTTCAGAAGGGGAACTTGATTTTGCAGAGAAGATCTGCAGTT
TTGTGCGTGAAATTTACAGGAACCTTACTCTTATTGCCCCAGAGATGGATGATAGTTCAGACATGAAACAGAAAATGGAAAACATGCTCC
AGAGTGTGATGAAGATAGAAAATGCTTGTTTT\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan