ESTScan Details for Unigene SGN-U219725

Score 
1144
Direction 
Forward
Predicted Peptide Sequence 
MPKDKIHFLSSSLDTSMPVNPPPLSLDLQGGGIDKRTIEKYEKEAAEMGKSSFKYAWVLDNLKAERERGITIDIALWKFESPKYQFTVID
APGHRDFIKNMITGTSQADVAILVIDSAPGGFEGGWAPDGQTREHALLAFTLGVQQMIVALNKMDACQYSEQRYNDIKEEVSGYLKKVGY
KPAKIPFVPISGWVGDNMIERSTNMNWYKGPILLEALDLVTPPKRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPNMQVCFGPIGL
TTEVKSVEMHHESLAEAVPGDNVGFNCKNIAVKDIKRGFVASNAAEDPAKGADSFQAQVIIMSHPGQIQNGYTPVLDCHTCHIATKFKNI
DEKMDRRTGKTLEANPKFVKSGDACMVTMEPTKPMVVETFNDYPPLGRFAVRDMRQTVAVGVIKSVIKKEDSKAGGKAAKKK
Predicted Coding Sequence 
ATGCCAAAGGATAAGATTCACTTTCTCTCGTCGTCATTGGACACGTCGATGCCGGTAAATCCACCACCACTGTCACTTGATCTACAAGGC
GGTGGTATTGATAAGCGTACCATCGAAAAGTACGAAAAGGAAGCCGCTGAAATGGGCAAGTCCTCCTTCAAATACGCCTGGGTTTTGGAT
AACTTGAAGGCTGAACGTGAAAGAGGTATCACCATCGATATCGCTCTCTGGAAATTCGAATCCCCAAAGTACCAATTCACTGTCATTGAT
GCCCCCGGACATCGTGATTTCATCAAGAATATGATCACTGGTACCTCCCAAGCTGATGTTGCCATCTTAGTCATTGACTCCGCTCCTGGT
GGCTTCGAAGGTGGCTGGGCTCCTGATGGCCAGACCCGTGAACACGCTTTATTAGCCTTCACCCTTGGTGTCCAACAGATGATTGTTGCC
CTCAACAAGATGGATGCCTGCCAGTACTCCGAACAACGTTACAACGATATCAAGGAAGAAGTCTCTGGTTACTTAAAGAAGGTCGGATAC
AAGCCAGCCAAGATCCCATTCGTCCCAATCTCTGGTTGGGTCGGAGACAACATGATTGAACGCTCCACCAACATGAACTGGTACAAGGGT
CCTATCCTGTTAGAAGCTCTTGACTTGGTCACTCCTCCTAAGCGCCCAACTGACAAGCCATTGCGTTTACCTTTACAGGACGTCTACAAG
ATCGGTGGTATCGGTACTGTCCCTGTCGGACGTGTCGAGACTGGTGTCTTGAAGCCTAACATGCAAGTGTGCTTCGGCCCAATCGGCTTA
ACCACTGAAGTTAAGTCCGTCGAAATGCACCACGAATCCCTCGCTGAAGCCGTCCCTGGTGACAACGTTGGTTTCAACTGCAAGAACATT
GCCGTCAAGGATATCAAGAGAGGTTTCGTCGCCTCCAACGCCGCCGAAGATCCTGCCAAGGGTGCTGATTCCTTCCAGGCTCAGGTCATC
ATCATGTCCCACCCTGGCCAGATCCAGAACGGTTACACTCCAGTCTTGGATTGCCACACCTGCCACATTGCCACCAAGTTCAAGAACATC
GATGAAAAGATGGATCGTCGTACTGGTAAGACTCTCGAAGCCAACCCAAAATTCGTCAAGTCCGGTGATGCCTGCATGGTCACCATGGAA
CCCACCAAGCCAATGGTTGTTGAGACCTTCAATGACTACCCACCATTAGGACGTTTCGCCGTTCGTGATATGAGACAGACCGTCGCCGTC
GGTGTCATCAAGTCCGTCATCAAGAAGGAAGACTCCAAGGCTGGTGGAAAGGCCGCCAAGAAGAAGTAA\
Edits in Original Sequence 
CAATAATTAACAAGTCAATATAAA(5')ATGCCAAAGGATAAGATTCACgTTTCTCTCGTCGTCATTGGACACGTCGATGCCGGTAAATC
CACCACCACTgGTCACTTGATCTACAAGtGCGGTGGTATTGATAAGCGTACCATCGAAAAGTACGAAAAGGAAGCCGCTGAAATGGGCAA
GTCCTCCTTCAAATACGCCTGGGTTTTGGATAACTTGAAGGCTGAACGTGAAAGAGGTATCACCATCGATATCGCTCTCTGGAAATTCGA
ATCCCCAAAGTACCAATTCACTGTCATTGATGCCCCCGGACATCGTGATTTCATCAAGAATATGATCACTGGTACCTCCCAAGCTGATGT
TGCCATCTTAGTCATTGACTCCGCTCCTGGTGGCTTCGAAGGTGGCTGGGCTCCTGATGGCCAGACCCGTGAACACGCTTTATTAGCCTT
CACCCTTGGTGTCCAACAGATGATTGTTGCCCTCAACAAGATGGATGCCTGCCAGTACTCCGAACAACGTTACAACGATATCAAGGAAGA
AGTCTCTGGTTACTTAAAGAAGGTCGGATACAAGCCAGCCAAGATCCCATTCGTCCCAATCTCTGGTTGGGTCGGAGACAACATGATTGA
ACGCTCCACCAACATGAACTGGTACAAGGGTCCTATCCTGTTAGAAGCTCTTGACTTGGTCACTCCTCCTAAGCGCCCAACTGACAAGCC
ATTGCGTTTACCTTTACAGGACGTCTACAAGATCGGTGGTATCGGTACTGTCCCTGTCGGACGTGTCGAGACTGGTGTCTTGAAGCCTAA
CATGCAAGTGTGCTTCGGCCCAATCGGCTTAACCACTGAAGTTAAGTCCGTCGAAATGCACCACGAATCCCTCGCTGAAGCCGTCCCTGG
TGACAACGTTGGTTTCAACTGCAAGAACATTGCCGTCAAGGATATCAAGAGAGGTTTCGTCGCCTCCAACGCCGCCGAAGATCCTGCCAA
GGGTGCTGATTCCTTCCAGGCTCAGGTCATCATCATGTCCCACCCTGGCCAGATCCAGAACGGTTACACTCCAGTCTTGGATTGCCACAC
CTGCCACATTGCCACCAAGTTCAAGAACATCGATGAAAAGATGGATCGTCGTACTGGTAAGACTCTCGAAGCCAACCCAAAATTCGTCAA
GTCCGGTGATGCCTGCATGGTCACCATGGAACCCACCAAGCCAATGGTTGTTGAGACCTTCAATGACTACCCACCATTAGGACGTTTCGC
CGTTCGTGATATGAGACAGACCGTCGCCGTCGGTGTCATCAAGTCCGTCATCAAGAAGGAAGACTCCAAGGCTGGTGGAAAGGCCGCCAA
GAAGAAGTAA\(3')ATGGTTGATTTCTAAAGCCCTTGTAATTAGTACCGAAGAAGAATTCATTTTTTCTTCATCTAGTTGTATAGCATA
GAAATCGATTATTTTCTCATTTTTGCCTGTAACTCTCCAAAGAAGCTGCAAACTCTTTACAAAAAAAAAAAAAAAAAACTCGAGGGGGGC
CCG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan