ESTScan Details for Unigene SGN-U219757

Score 
727
Direction 
Forward
Predicted Peptide Sequence 
PLPVSVTGGLLTRKSSSDSTNLVDXEEEEAVDMGERKVLNKYYPPDFDPGKDSQAKTAEESADESAYDASNEYSVVLLAEITSIRVPNSI
PAKRTLLARLIWEYKSSDSILSAQSAPAEITYKTDPKNSDYTVESGATRNFEPWRGKDEEIEKEKQKRDDEEMGDAMKSLENRTLDSKRE
MDILAGLDEMKSLKSRHATVSVDAMLEALQRSHESKEKKMEEDDEALIRSIFQGSRETVKRINDEELEDDDDDDMAFFTRESAGSENNSX
KGTSAWSSYSVFQIPTVILPTTYFCTTQN
Predicted Coding Sequence 
XXCCCTTTGCCTGTCTCTGTTACAGGAGGGTTGCTTACTCGCAAATCTTCATCCGATTCAACTAATTTGGTGGACTGAGAAGAAGAAGAA
GCAGTAGACATGGGAGAAAGGAAGGTTTTAAACAAGTATTATCCGCCGGATTTCGATCCXGGCAAAGATTCCCAGGCGAAGACAGCCGAA
GAATCAGCAGATGAAAGTGCGTATGATGCTTCCAATGAGTATTCXGTTGTGCTACTTGCGGAAATTACATCTATAAGGGTACCAAATTCA
ATTCCCGCAAAGAGGACGTTGTTGGCGAGACTTATTTGGGAATACAAATCTTCAGATTCTATTTTAAGTGCACAAAGTGCTCCXGCAGAG
ATTACTTACAAGACAGACCCCAAGAATTCCGATTATACTGTTGAATCAGGTGCAACTAGGAATTTTGAGCCTTGGCGTGGCAAAGACGAG
GAAATTGAGAAGGAGAAACAAAAAAGAGACGATGAAGAAATGGGTGATGCAATGAAGTCCTTAGAAAATAGGACATTGGATTCAAAGAGA
GAAATGGATATTCTTGCTGGTTTAGATGAAATGAAATCTCTGAAGTCAAGGCACGCCACTGTGAGTGTAGATGCGATGCTTGAAGCTTTG
CAGCGGTCACATGAATCCAAGGAAAAGAAGATGGAGGAAGACGATGAAGCTCTCATAAGATCAATTTTCCAGGGATCAAGAGAGACTGTC
AAAAGAATCAATGATGAAGAACTTGAGGACGATGACGATGATGACATGGCTTTCTTTACCCGTGAAAGTGCAGGGTCAGAAAACAACTCT
XCTAAAGGTACAAGTGCCTGGTCATCTTATTCAGTTTTCCAAATTCCAACTGTTATATTGCCAACAACCTACTTCTGTACAACACAGAAC
TAA\
Edits in Original Sequence 
(5')XXCCCTTTGCCTGTCTCTGTTACAGaGAGGGTTGCTTACTCGCAAATCTTCATCCGATTCAACTAATTTGGTGGACTGAGAAGAAG
AAGAAGCAGTAGACATGGGAGAAAGGAAGGTTTTAAACAAGTATTATCCGCCGGATTTCGATCCXGGCAAAGATTCCCAGGCGAAGACAG
CCGAAGAATCAGCAGATGAAAGTGCGTATGATGCTTCCAATGAGTATTCXGTTGTGCTACTTGCGGAAATTACATCTATAAGGGTACCAA
ATTCAATTCCCGCAAAGAGGACGTTGTTGGCGAGACTTATTTGGGAATACAAATCTTCAGATTCTATTTTAAGTGCACAAAGTGCTCCXG
CAGAGATTACTTACAAGACAGACCCCAAGAATTCCGATTATACTGTTGAATCAGGTGCAACTAGGAATTTTGAGCCTTGGCGTGGCAAAG
ACGAGGAAATTGAGAAGGAGAAACAAAAAAGAGACGATGAAGAAATGGGTGATGCAATGAAGTCCTTAGAAAATAGGACATTGGATTCAA
AGAGAGAAATGGATATTCTTGCTGGTTTAGATGAAATGAAATCTCTGAAGTCAAGGCACGCCACTGTGAGTGTAGATGCGATGCTTGAAG
CTTTGCAGCGGTCACATGAATCCAAGGAAAAGAAGATGGAGGAAGACGATGAAGCTCTCATAAGATCAATTTTCCAGGGATCAAGAGAGA
CTGTCAAAAGAATCAATGATGAAGAACTTGAGGACGATGACGATGATGACATGGCTTTCTTTACCCGTGAAAGTGCAGGGTCAGAAAACA
ACTCTXCTAAAGGTACAAGTGCCTGGTCATCTTATTCAGTTTTCCAAATTCCAACTGTTATATTGCCAACAACCTACTTCTGTACAACAC
AGAACTAA\(3')ACAATTAAATGGCAGCATCTACAAAATGATTAATCTCCTTTACATTGGACCTGCCATATGTCTGATATACAACTAAA
GAAAAGTAGAAAATACAATGTAAATTCATAAATTAGATTACAGCTCTGTTGGGAGCAGCGCATCTACTGTTAGACTTAAATCTGAATGCA
ATATCATGTCTTAAACTTCTTTTGGTGTTCCATTTAAACACTATGCTTATTATTGTGTAAATGCAGAAGAGAAAGGTTTCGGAGGAACCT
GATGAAAAGCCCACAGACTTTTTGACGAAAGCCAGCATTAATGACATCTCTAAAAACAAAGGTAGGTTGAGTTTATTCATCTGATTCCCT
TCTGAGGGTATCATTGCTTCCCATAATTCCAACATCCTTGTATGACATTTGGTGGATGAAATATTATAAACTCTTCAATGATTGTAGAAT
TCGTA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan