ESTScan Details for Unigene SGN-U219774

Score 
564
Direction 
Reverse
Predicted Peptide Sequence 
RDLCSSSGRTGRAGKKGSAILMHSSKQHRDVKGIEHDAGCRFTELPTIKVEAGAVEMYSEMGKDDGRFGSSGGGTMRSRSSDFGGGRSGG
YGNKSSKFGREVSSSSFRTGGYSATGSGRSRGGFSGPSSGRSGKFGGGSGDTRGSKRLGGFRNFGGFGSSKSSNRSNNFAEEFDSGRSRR
FGDSDHDRNNRSSRFDVFGDDNEVVNGDQSWRRTISNSVARRCGHSIDDGEDETPICEVCMFITRCCRVAAAADGDARLVTVENNTSTST
WSPKVPTXLYVTDSYQVLTIAGRYVSSLYA
Predicted Coding Sequence 
AGAGATCTTTGTTCATCATCTGGTCGAACTGGACGTGCTGGTAAGAAAGGAAGTGCCATTCTCATGCATTCCTCAAAACAGCATAGGGAT
GTAAAAGGTATTGAACATGATGCCGGATGCAGATTTACAGAGCTCCCAACAATTAAAGTAGAGGCTGGAGCAGTAGAAATGTATAGTGAA
ATGGGAAAAGATGATGGCCGCTTTGGTTCCTCTGGAGGAGGCACTATGCGTAGTCGATCTAGTGATTTTGGTGGAGGCCGTTCTGGTGGC
TATGGAAATAAGAGCAGCAAGTTTGGTCGAGAAGTCTCTTCATCTTCTTTTCGAACAGGTGGATATAGCGCAACTGGTTCAGGAAGATCA
AGAGGTGGCTTTAGCGGACCTAGCTCAGGCCGCTCAGGAAAGTTTGGTGGTGGTTCAGGAGACACACGAGGCTCAAAACGTTTGGGTGGT
TTCCGCAACTTTGGTGGTTTTGGAAGCTCCAAAAGTTCAAATCGATCGAATAATTTTGCAGAAGAGTTTGATTCAGGCCGTTCTAGAAGA
TTCGGAGATTCAGATCATGATCGAAACAACCGTTCAAGCCGTTTTGATGTCTTCGGAGATGACAATGAAGTGGTGAATGGTGATCAGAGT
TGGAGGAGAACTATTTCTAACTCTGTTGCAAGGAGGTGTGGCCACTCAATAGATGATGGTGAAGATGAAACTCCGATATGTGAAGTGTGT
ATGTTTATTACCAGGTGCTGTAGAGTAGCAGCAGCTGCAGATGGTGATGCTCGACTCGTTACAGTAGAAAATAACACTTCAACATCCACT
TGGTCTCCAAAGGTACCTACACXGCTATATGTAACCGATAGCTACCAAGTTCTCACCATTGCTGGXCGTTATGTTTCTTCGCTGTATGCT
TGA\
Edits in Original Sequence 
(5')AGAGATCTTTGTTCATCgATCTGGTCGAACTGGACGTGCTGGTAAGAAAGGAAGTGCCATTCTCATGCATTCCTCAAAACAGCATA
GGGATGTAAAAGGTATTGAACATGATGCCGGATGCAGATTTACAGAGCTCCCAACAATTAAAGTAGAGGCTGGAGCAGTAGAAATGTATA
GTGAAATGGGAAAAGATGATGGCCGCTTTGGTTCCTCTGGAGGAGGCACTATGCGTAGTCGATCTAGTGATTTTGGTGGAGGCCGTTCTG
GTGGCTATGGAAATAAGAGCAGCAAGTTTGGTCGAGAAGTCTCTTCATCTTCTTTTCGAACAGGTGGATATAGCGCAACTGGTTCAGGAA
GATCAAGAGGTGGCTTTAGCGGACCTAGCTCAGGCCGCTCAGGAAAGTTTGGTGGTGGTTCAGGAGACACACGAGGCTCAAAACGTTTGG
GTGGTTTCCGCAACTTTGGTGGTTTTGGAAGCTCCAAAAGTTCAAATCGATCGAATAATTTTGCAGAAGAGTTTGATTCAGGCCGTTCTA
GAAGATTCGGAGATTCAGATCATGATCGAAACAACCGTTCAAGCCGTTTTGATGTCTTCGGAGATGACAATGAtAGTGGTGAATGGTGAT
CAGAGTTGGAGGAGAACTATTTCTAACTCTGTTGCAAGGAGGTGTGGCCACTCAATAGATGATGGTGAAGATGAAACTCCGATATGTGAA
GTGTGTATGTTTATTACCAGGTGCTGTAGAGTAGCAGCAGCTGCAGATGGTGATGCTaCGACTCGTTACAGTAGAAAATAACACTTCAAC
ATCCACTTGGTCTCCAAAGGTACCTACACXGCTATATGTAACCGATAGCTACCAAGTTCTCACCATTGCTGGXCGTTATGTTTCTTCGCT
GTATGCTTGA\(3')AATAAATATTTTTTTTGCAAGAGATCATATTGGTACTTGCTAGTGATAGTGGTTGTAATGTTCAAGAGATCATAT
TGGTACTTGCTAGTGATAGTGGTTGTAATGTTCAGTATAAATTTTGAACAGACCTTGATCTTATTATTTAACCAGTTTATGAGGATGTAT
TCAATTTGTTGAATCAAACAGGTGAAAAGGCTTATATTGAAAGTATATTGTTTTTCTTTCGCACTTGTAAAAAAAAAAAAAAAAAAAAAA
ACTCG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan