ESTScan Details for Unigene SGN-U219783

Score 
702
Direction 
Forward
Predicted Peptide Sequence 
KTLIPLAEKKEGVAXKMVFTISSNPVQFTHTTSLNARPNCYLKASVPVSNLSFSFFRHEYIRFSVKSRLNKRMVCAAASAAGSSSSSDDS
NPYEVLGVNPIEGFDMVKAAYARRRKDAERRGDEATLAQLEKAYDKIMMSQLTKRKQGVTFGSFKVSKEVRYADKQPILPWGPRFTKSDD
KDIKINLAISAVFIAWVFINRNAEWKPLQFLAFAFVYRIFEKLKAFEPPTPTFT
Predicted Coding Sequence 
XXGAAAACCCTAATCCCTTTAGCAGAGAAGAAAGAAGGAGTAGCTXCAAAAATGGTGTTTACAATATCATCAAACCCTGTTCAGTTTACA
CATACTACTTCTTTAAATGCTCGACCCAATTGTTATCTCAAAGCTTCTGTTCCAGTTTCAAATTTATCGTTTTCTTTCTTCAGACATGAA
TACATCAGGTTTTCTGTAAAATCTCGCCTGAATAAAAGGATGGTCTGTGCTGCTGCTTCAGCTGCTGGAAGTTCTAGTTCTAGCGATGAC
TCAAATCCTTATGAGGTTCTGGGTGTAAACCCTATTGAGGGATTTGACATGGTTAAGGCAGCATATGCAAGGAGAAGGAAAGATGCTGAG
CGGAGGGGTGATGAAGCAACGCTTGCTCAGTTGGAGAAGGCTTATGACAAAATCATGATGTCACAGTTAACAAAAAGGAAGCAGGGTGTC
ACTTTTGGCTCGTTTAAGGTATCTAAAGAGGTACGATATGCTGATAAGCAGCCTATTTTGCCATGGGGTCCACGGTTCACCAAATCTGAT
GACAAAGATATCAAAATCAACTTGGCAATTTCAGCTGTATTTATAGCTTGGGTTTTTATAAATCGTAATGCTGAGTGGAAGCCTTTACAG
TTTTTGGCCTTCGCCTTTGTATATAGGATATTTGAGAAATTAAAAGCATTTGAGCCTCCAACTCCCACGTTTACX\
Edits in Original Sequence 
(5')XXGAAAACCCTAATCCCTTTAGCAGAGAAGAAAGAAGGAGTAGCTXCAAAAATGGTGTTTACAATATCATCAAACCCTGTTCAGTT
TACACATACTACTTCTTTAAATGCTCGACCCAATTGTTATCTCAAAGCTTCTGTTCCAGTTTCAAATTTATCGTTTTCTTTCTTCAGACA
TGAATACATCAGGTTTTCTGTAAAATCTCGCCTGAATAAAAGGATGGTCTGTGCTGCTGCTTCAGCTGCTGGAAGTTCTAGTTCTAGCGA
TGACTCAAATCCTTATGAGGTTCTGGGTGTAAACCCTATTGAGGGATTTGACATGGTTAAGGCAGCATATGCAAGGAGAAGGAAAGATGC
TGAGCGGAGGGGTGATGAAGCAACGCTTGCTCAGTTGGAGAAGGCTTATGACAAAATCATGATGTCACAGTTAACAAAAAGGAAGCAGGG
TGTCACTTTTGGCTCGTTTAAGGTATCTAAAGAGGTACGATATGCTGATAAGCAGCCTATTTTGCCATGGGGTCCACGGTTCACCAAATC
TGATGACAAAGATATCAAAATCAACTTGGCAATTTCAGCTGTATTTATAGCTTGGGTTTTTATAAATCGTAATGCTGAGTGGAAGCCTTT
ACAGTTTTTGGCCTTCGCCTTTGTATATAGGATATTTGAGAAATTAAAAGCATTTGAGCCTCCAACTCCCACGTTTACX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan