ESTScan Details for Unigene SGN-U219836

Score 
940
Direction 
Forward
Predicted Peptide Sequence 
WPKSLEVQILDPSKAMKKPVGVLHVKILRAMNLKKKDLLGASDPYVKLKLTESKLPSKKTPVRHKNLNPEWNEEFNMVVKDPESQALELS
VYDWEKIGKHDKMGMNVIPLKDLTPDETKTMTLSLLKNMDANDSQNDKDRGQIMVELTYKPFKEDELPKDFEDNDAAHKVPEGTPPGGGV
LMIIVHEAQDVEGKHHTNPYVKILFKGEERKTKQVKKNRDPRWEEEFTFVLEEPPVNDRVHMEVVSTSTRIGLLHPKETLGYVDINLSDV
VSNKRINEKYHLIDSKNGRLQVELQWRTAS
Predicted Coding Sequence 
XTTTGGCCTAAATCTCTAGAAGTGCAGATATTGGATCCATCCAAAGCAATGAAAAAACCTGTTGGGGTCCTGCATGTGAAGATTCTGAGG
GCTATGAATCTGAAAAAAAAAGATCTACTGGGTGCATCTGATCCTTACGTAAAACTTAAGCTCACTGAGTCAAAACTTCCTTCAAAGAAA
ACCCCTGTAAGGCATAAGAATTTAAACCCAGAGTGGAATGAGGAATTTAATATGGTTGTTAAAGATCCAGAATCGCAAGCATTGGAGCTC
TCTGTTTATGATTGGGAGAAGATTGGCAAGCATGATAAGATGGGCATGAACGTTATTCCACTGAAAGATTTGACTCCTGATGAAACAAAA
ACGATGACACTGAGTCTCCTAAAGAACATGGATGCGAATGATTCTCAAAATGATAAGGACCGTGGTCAGATCATGGTGGAATTAACCTAC
AAACCATTTAAGGAGGATGAGTTGCCAAAAGATTTTGAAGATAATGATGCAGCACATAAGGTTCCAGAAGGAACACCACCAGGGGGAGGC
GTCCTTATGATTATTGTCCACGAAGCTCAAGATGTTGAAGGAAAGCACCATACTAATCCATATGTCAAGATTCTTTTCAAAGGAGAGGAG
AGAAAAACTAAGCAAGTCAAGAAGAACAGGGATCCAAGATGGGAAGAGGAGTTTACTTTTGTGTTGGAGGAGCCTCCTGTGAATGATAGG
GTGCATATGGAAGTTGTCAGCACCTCTACAAGGATTGGCCTATTGCATCCTAAGGAGACATTGGGTTATGTTGATATAAATCTTTCCGAT
GTTGTTAGCAACAAAAGGATCAATGAGAAGTACCACCTCATTGATTCAAAGAACGGTCGCCTTCAAGTCGAGCTGCAATGGCGAACCGCA
TCTTGA\
Edits in Original Sequence 
(5')XTTTGGCCTAAATCTCTAGAAGTGCAGATATTGGATCCATCCAAAGCAATGAAAAAACCTGTTGGGGTCCTGCATGTGAAGATTCT
GAGGGCTATGAATCTGAAAAAAAAAGATCTACTGGGTGCATCTGATCCTTACGTAAAACTTAAGCTCACTGAGTCAAAACTTCCTTCAAA
GAAAACCCCTGTAAGGCATAAGAATTTAAACCCAGAGTGGAATGAGGAATTTAATATGGTTGTTAAAGATCCAGAATCGCAAGCATTGGA
GCTCTCTGTTTATGATTGGGAGAAGATTGGCAAGCATGATAAGATGGGCATGAACGTTATTCCACTGAAAGATTTGACTCCTGATGAAAC
AAAAACGATGACACTGAGTCTCCTAAAGAACATGGATGCGAATGATTCTCAAAATGATAAGGACCGTGGTCAGATCATGGTGGAATTAAC
CTACAAACCATTTAAGGAGGATGAGTTGCCAAAAGATTTTGAAGATAATGATGCAGCACATAAGGTTCCAGAAGGAACACCACCAGGGGG
AGGCGTCCTTATGATTATTGTCCACGAAGCTCAAGATGTTGAAGGAAAGCACCATACTAATCCATATGTCAAGATTCTTTTCAAAGGAGA
GGAGAGAAAAACTAAGCAAGTCAAGAAGAACAGGGATCCAAGATGGGAAGAGGAGTTTACTTTTGTGTTGGAGGAGCCTCCTGTGAATGA
TAGGGTGCATATGGAAGTTGTCAGCACCTCTACAAGGATTGGCCTATTGCATCCTAAGGAGACATTGGGTTATGTTGATATAAATCTTTC
CGATGTTGTTAGCAACAAAAGGATCAATGAGAAGTACCACCTCATTGATTCAAAGAACGGTCGCCTTCAAGTCGAGCTGCAATGGCGAAC
CGCATCTTGA\(3')GCTAATTGCAACTTCCATGCCTGAACTTGTTTTCTTTTTCTTCTGTTTCTTTTTTTTTTTTGTTCTCTTGATTCT
TCTTTTCATGATGGATGTTTGAGGAGTGAAGACATAAATATTTCTTTTTTCAGTTCTTAAGCTGGAATAATCTCTGCAATTGTTTGTACA
TTAGTACATAACAACCTTGTTTGATTAAAATGTTTTTTTTTTGGTTGTTGCTCAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan