ESTScan Details for Unigene SGN-U219928

Score 
538
Direction 
Forward
Predicted Peptide Sequence 
SRNSEVKYVHKKQSGGSGQFADITVRFEPMEAGGGYEFKSEIKGGAVPKEYIPGVMKGLEECMSNGVLAGFPVVDVRAVLVDGSYHDVDS
SVLAFQLAARGAFREGMRKAGPQLLEPIMKVEVVTPEEHLGDVIGDLNSRRGQINSFGDKPGGLKVVDSLVPLAEMFNYVSTLRGMTKGR
ASYVMQLAKFDVVPQHIQNQLAKKEEAAAAXVSHLPDFGSTNLKIGIFLDEDVKAWTTFFLYVPAWNTDGEXADIXVMRLSFFRRLCMLL
SYKLRLRRDGRKKEGNVYTCI
Predicted Coding Sequence 
XTTTCCAGGAACTCAGAAGTAAAATACGTGCATAAGAAGCAGTCTGGTGGTTCAGGACAGTTTGCTGATATCACAGTAAGGTTTGAACCC
ATGGAAGCAGGTGGTGGATATGAATTCAAGAGTGAAATCAAGGGAGGTGCAGTGCCAAAAGAATATATCCCTGGTGTTATGAAGGGATTA
GAAGAATGCATGAGTAACGGAGTACTGGCAGGCTTTCCAGTTGTTGATGTTCGTGCTGTGCTAGTAGATGGATCTTACCATGATGTGGAT
TCAAGTGTTTTGGCATTCCAGCTGGCTGCTCGGGGAGCTTTTAGGGAAGGGATGAGAAAAGCTGGTCCACAATTGCTAGAACCCATAATG
AAGGTTGAAGTAGTTACACCAGAAGAACATCTAGGGGATGTGATTGGTGACCTTAACTCAAGGAGAGGCCAGATCAACAGCTTTGGAGAC
AAGCCTGGAGGTCTCAAGGTGGTGGATTCTTTAGTTCCATTAGCAGAGATGTTCAATTACGTTAGTACCTTGCGAGGAATGACAAAGGGG
CGTGCATCGTATGTTATGCAGTTAGCCAAATTTGACGTTGTCCCTCAACACATTCAAAACCAGCTTGCCAAAAAGGAGGAAGCAGCTGCT
GCTXTAGTCAGTCATCTTCCAGATTTTGGATCCACAAACTTGAAAATAGGTATTTTTCTCGACGAAGATGTTAAGGCTTGGACAACATTC
TTTTTGTACGTACCAGCATGGAACACCGATGGAGAAXTAGCTGATATTXTAGTCATGCGTCTGAGTTTTTTCAGACGTTTGTGTATGTTG
TTGAGTTATAAGCTGAGACTCCGAAGAGACGGAAGAAAGAAAGAAGGAAATGTGTATACATGCATTTAA\
Edits in Original Sequence 
(5')XTTTCCAGGAACTCAGAAGTAAAATACGTGCATAAGAAGCAGTCTGGTGGTTCAGGACAGTTTGCTGATATCACAGTAAGGTTTGA
ACCCATGGAAGCAGGTGGTGGATATGAATTCAAGAGTGAAATCAAGGGAGGTGCAGTGCCAAAAGAATATATCCCTGGTGTTATGAAGGG
ATTAGAAGAATGCATGAGTAACGGAGTACTGGCAGGCTTTCCAGTTGTTGATGTTCGTGCTGTGCTAGTAGATGGATCTTACCATGATGT
GGATTCAAGTGTTTTGGCATTCCAGCTGGCTGCTCGGGGAGCTTTTAGGGAAGGGATGAGAAAAGCTGGTCCACAATTGCTAGAACCCAT
AATGAAGGTTGAAGTAGTTACACCAGAAGAACATCTAGGGGATGTGATTGGTGACCTTAACTCAAGGAGAGGCCAGATCAACAGCTTTGG
AGACAAGCCTGGAGGTCTCAAGGTGGTGGATTCTTTAGTTCCATTAGCAGAGATGTTCAATTACGTTAGTACCTTGCGAGGAATGACAAA
GGGGCGTGCATCGTATGTTATGCAGTTAGCCAAATTTGACGTTGTCCCTCAACACATTCAAAACCAGCTTGCCAAAAAGGAGGAAGCAGC
TGCTGCTXTAGTCAGTCATCTTCCAGATTTTGGATCCACAAACTTGAAAATAGGTATTTTTaCTCGACGAAGATGTTAAGGCTTGGACAA
CATTCTTTTTGTACGTACCAGCATGGAACACCGATGGAGAAXTAGCTGATATTXTAGTCATGCGTCTGAGTTTTTTCAGACGTTTGTGTA
TGTTGTTGAGTTATAAGCTGAGACTCCGAAGAGACGGAAGAAAGAAAGAAGGAAATGTGTATACATGCATTTAA\(3')GATGTCTCTAC
ATCCAAAAGAAGCATCAATATTTTAGGGCAAGATTGAGTGTGTCTCCGATTGTGGGATTATTTTTCTTACTATAGAAATAAATATATGCT
TTGTAACAATCTGATGCTCTTTATTGAGATCTTAGGTGTAACATCTGACGATTTTGAGTTGCTTATTTCACGTTTGTTTTTACTTTGCAA
AAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan