ESTScan Details for Unigene SGN-U220083

Score 
91
Direction 
Forward
Predicted Peptide Sequence 
MSLFSPXKQLRIATDDFSTLNKIGEGGFGSVYKVMTTVLLLPCYELGFEYYMFNKSYGILLYDAXEQGRLKSGKMAAIKVLSSESKQGVR
EFLTEIKVISDVDHENLVKLYGLCIEDDHRILVYNYLEKHSLAQX
Predicted Coding Sequence 
ATGTCACTCTTTTCTCCTXATAAGCAGTTAAGAATCGCCACAGATGATTTTAGTACTTTAAATAAAATTGGAGAGGGTGGATTTGGTTCT
GTTTATAAGGTAATGACAACTGTTCTCCTTCTACCTTGTTATGAATTGGGGTTCGAATATTATATGTTTAATAAGTCTTATGGGATTTTA
CTATATGATGCTXATGAACAGGGAAGGCTAAAAAGTGGAAAGATGGCTGCTATAAAGGTTCTTTCAAGTGAATCAAAGCAAGGTGTCAGG
GAGTTCTTGACAGAAATCAAAGTAATTTCAGACGTTGACCATGAAAATCTAGTGAAACTCTATGGGCTGTGTATAGAAGACGATCACAGG
ATATTGGTCTACAACTATCTTGAAAAACACAGCCTTGCTCAAAXX\
Edits in Original Sequence 
GTTTTTTCTTTAAGTTTGCAGGCTCTGATTTTGGTTGATATCATATACAGAAGGTCATTGGTGCATCCTAAAGTTATGACTTGCTTCCCT
TTGTTCCATAGAAAACATCAGTCATCAACTAGGCATGCATCTGAATTTGATGATGGTAAGCATTAAAAGTCTGCCCAATATATAATTTTT
GGATGTTCTTAGTAATTGTGACATTCAATATTCTTTTATCTTTTCGTATACCACATATAAGTTGTTATGTATGTCAAAAAGATACTAAAA
AGTTGATCCACAACAGAGCTCTCTGGCGTCAAGA
(5')ATGTCACTCTTTTCTCCTXATAAGCAGTTAAGAATCGCCACAGATGATTTTA
GTACTTTAAATAAAATTGGAGAGGGTGGATTTGGTTCTGTTTATAAGGTAATGACAACTGTTCTCCTTCTACCTTGTTATGAATTaGGGG
TTCGAATATTATATGTTTAATAAGTCTTATGGGATTTTACTATATGATGCTXATGAACAGGGAAGGCTAAAAAGTGGAAAGATGGCTGCT
ATAAAGGTTCTTTCAAGTGAATCAAAGCAAGGTGTCAGGGAGTTCTTGACAGAAATCAAAGTAATTTCAGACGTTGACCATGAAAATCTA
GTGAAACTCTATGGGCTGTGTATAGAAGACGATCACAGGATATTGGTCTACAACTATCTTGAAAAACACAGCCTTGCTCAAAXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan