ESTScan Details for Unigene SGN-U220125

Score 
390
Direction 
Forward
Predicted Peptide Sequence 
RCTTAEAQSTCAGRDTPGAVLAARFNSNGEYALSCGKDRTIRLWNPHRGVHIKTYKAHGREVRDVHVTQDNSKLCSCGGDRQVFYWDVST
GHVIRKFRGHDSEVNAVKFNEYASVVVSAGYDKSLRVWDCKSRSTEPIQIIDTFLDSVMSICLTKTEIIAGSVDGTVRTFDIRVGREISD
NLGQPVNCISLSNDGNCILASCLDSTLRLLDRSSGELCKNIRAIFASLSKRTAXLTNSDAHVAGGSEDGYIYFWDLVDASVVSSFRAHDL
VVTSVSYHPKENCMITSSVDSTVRVWKAMRYGTKNASDLFLTTSHEERCVLKSNQQFYERILLTELSMRIIAKEYLNAITKVSIWVLYLQ
W
Predicted Coding Sequence 
CGCTGTACAACTGCCGAAGCACAAAGTACATGTGCTGGAAGAGACACGCCCGGAGCTGTTTTGGCGGCGAGGTTCAATAGCAACGGCGAG
TACGCACTGAGCTGCGGCAAAGACCGTACCATCCGGCTATGGAATCCTCACCGTGGAGTTCACATCAAAACTTACAAAGCTCACGGCCGT
GAAGTCCGCGATGTCCATGTCACTCAGGACAATTCAAAACTTTGTTCATGTGGTGGCGATCGACAAGTATTTTATTGGGATGTCTCAACA
GGTCATGTCATTCGCAAATTTCGTGGCCATGACAGTGAGGTGAATGCTGTGAAGTTTAATGAATATGCTTCTGTTGTAGTATCAGCAGGA
TATGATAAATCATTGCGTGTTTGGGATTGCAAATCTCGCAGCACTGAACCAATTCAGATCATTGATACCTTTCTAGATAGTGTGATGTCA
ATTTGTCTCACAAAAACTGAGATAATTGCTGGAAGTGTTGATGGAACAGTTCGAACATTTGACATCAGAGTTGGTAGAGAGATATCTGAT
AATTTGGGTCAGCCTGTCAACTGTATCTCTCTTTCAAATGATGGCAACTGTATATTAGCAAGTTGCCTGGATTCAACCCTTCGACTTCTG
GACAGGTCTAGTGGTGAACTATGCAAGAATATAAGGGCCATATTTGCAAGTCTTTCAAAACGGACTGCTGXTCTTACAAACAGTGATGCC
CATGTTGCTGGCGGCTCAGAAGATGGCTATATCTACTTCTGGGATCTGGTCGATGCGTCAGTTGTATCCAGCTTCCGAGCGCATGATTTA
GTGGTAACTAGCGTAAGTTATCACCCAAAAGAAAACTGCATGATAACTTCTTCTGTAGATAGCACAGTCCGAGTTTGGAAAGCXATGAGA
TATGGAACCAAAAACGCATCTGATCTTTTCCTGACAACCTCACATGAAGAAAGATGTGTACTCAAATCAAACCAACAGTTTTATGAGAGA
ATACTGCTCACTGAGTTGAGCATGAGAATTATCGCAAAGGAATACCTCAATGCCATCACAAAGGTGTCAATCTGGGTTTTATACTTGCAA
TGG\
Edits in Original Sequence 
(5')CGCTGTACAACTGCCGAAGCACAAAGTACATGTGCTGGAAGAGACACGCCCGGAGCTGTTTTGGCGGCGAGGTTCAATAGCAACGG
CGAGTACGCACTGAGCTGCGGCAAAGACCGTACCATCCGGCTATGGAATCCTCACCGTGGAGTTCACATCAAAACTTACAAAGCTCACGG
CCGTGAAGTCCGCGATGTCCATGTCACTCAGGACAATTCAAAACTTTGTTCATGTGGTGGCGATCGACAAGTATTTTATTGGGATGTCTC
AACAGGTCATGTCATTCGCAAATTTCGTGGCCATGACAGTGAGGTGAATGCTGTGAAGTTTAATGAATATGCTTCTGTTGTAGTATCAGC
AGGATATGATAAATCATTGCGTGTTTGGGATTGCAAATCTCGCAGCACTGAACCAATTCAGATCATTGATACCTTTCTAGATAGTGTGAT
GTCAATTTGTCTCACAAAAACTGAGATAATTGCTGGAAGTGTTGATGGAACAGTTCGAACATTTGACATCAGAGTTGGTAGAGAGATATC
TGATAATTTGGGTCAGCCTGTCAACTGTATCTCTCTTTCAAATGATGGCAACTGTATATTAGCAAGTTGCCTGGATTCAACCCTTCGACT
TCTGGACAGGTCTAGTGGTGAACTAtTGCAAGAATATAAGGGCCATATTTGCAAGTCTTTCAAAACGGACTGCTGXTCTTACAAACAGTG
ATGCCCATGTTGCTGGCGGCTCAGAAGATGGCTATATCTACTTCTGGGATCTGGTCGATGCGTCAGTTGTATCCAGCTTCCGAGCGCATG
ATTTAGTGGTAACTAGCGTAAGTTATCACCCAAAAGAAAACTGCATGATAACTTCTTCTGTAGATAGCACAGTCCGAGTTTGGAAAGCXA
TGAGATATGGAACCAAAAACGCATCTGATCTTTTCCTGACAACCTCACATGAAGAAAGATGTGTACTCAAATCAAACCAACAGTTTTATG
AGAGAATACTGCTCACTGAGTTGAGCATGAGAATTATCGCAAAGGtAATACCTCAATGCCATCACAAAGGTGTCAATCTGGGTTTTATAC
TTGCAATGG\(3')GTGAGTTTGACTCTTTATATTTCAAGTTAACTACTATGTATCTGGTGGTTCTGTCGTGATCGTTCGTTCCGTGATA
TAGTTGTGTTATAGACTTGTTATTTTTTATCATCTGATTTCACCTTTTCTCCCCCCATATGTGTTTTGGGGAGGGGGTGGTGATTTTCAG
ATAGGATGATGTAGCTTTTTCGAAAGTATCCCTTTTCACTTGATTATGTACTCAATGATAAATATAAACAAAGATTTAGACTAAAAAAAA
AAAAAACTCAGACTAGTCTCT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan